Microtus oregoni (creeping vole): 121464173 Help Entry 121464173         CDS       T08307                                  Symbol Rhoa Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism morg  Microtus oregoni (creeping vole) Pathway morg04014   Ras signaling pathway morg04015   Rap1 signaling pathway morg04022   cGMP-PKG signaling pathway morg04024   cAMP signaling pathway morg04062   Chemokine signaling pathway morg04071   Sphingolipid signaling pathway morg04072   Phospholipase D signaling pathway morg04081   Hormone signaling morg04144   Endocytosis morg04150   mTOR signaling pathway morg04270   Vascular smooth muscle contraction morg04310   Wnt signaling pathway morg04350   TGF-beta signaling pathway morg04360   Axon guidance morg04510   Focal adhesion morg04520   Adherens junction morg04530   Tight junction morg04611   Platelet activation morg04621   NOD-like receptor signaling pathway morg04625   C-type lectin receptor signaling pathway morg04660   T cell receptor signaling pathway morg04670   Leukocyte transendothelial migration morg04722   Neurotrophin signaling pathway morg04810   Regulation of actin cytoskeleton morg04921   Oxytocin signaling pathway morg04928   Parathyroid hormone synthesis, secretion and action morg04972   Pancreatic secretion morg05100   Bacterial invasion of epithelial cells morg05132   Salmonella infection morg05133   Pertussis morg05135   Yersinia infection morg05152   Tuberculosis morg05163   Human cytomegalovirus infection morg05200   Pathways in cancer morg05203   Viral carcinogenesis morg05205   Proteoglycans in cancer morg05206   MicroRNAs in cancer morg05210   Colorectal cancer morg05417   Lipid and atherosclerosis morg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121464173 (Rhoa)    04015 Rap1 signaling pathway     121464173 (Rhoa)    04310 Wnt signaling pathway     121464173 (Rhoa)    04350 TGF-beta signaling pathway     121464173 (Rhoa)    04072 Phospholipase D signaling pathway     121464173 (Rhoa)    04071 Sphingolipid signaling pathway     121464173 (Rhoa)    04024 cAMP signaling pathway     121464173 (Rhoa)    04022 cGMP-PKG signaling pathway     121464173 (Rhoa)    04150 mTOR signaling pathway     121464173 (Rhoa)   09133 Signaling molecules and interaction    04081 Hormone signaling     121464173 (Rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121464173 (Rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     121464173 (Rhoa)    04520 Adherens junction     121464173 (Rhoa)    04530 Tight junction     121464173 (Rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121464173 (Rhoa)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     121464173 (Rhoa)    04621 NOD-like receptor signaling pathway     121464173 (Rhoa)    04625 C-type lectin receptor signaling pathway     121464173 (Rhoa)    04660 T cell receptor signaling pathway     121464173 (Rhoa)    04670 Leukocyte transendothelial migration     121464173 (Rhoa)    04062 Chemokine signaling pathway     121464173 (Rhoa)   09152 Endocrine system    04921 Oxytocin signaling pathway     121464173 (Rhoa)    04928 Parathyroid hormone synthesis, secretion and action     121464173 (Rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     121464173 (Rhoa)   09154 Digestive system    04972 Pancreatic secretion     121464173 (Rhoa)   09156 Nervous system    04722 Neurotrophin signaling pathway     121464173 (Rhoa)   09158 Development and regeneration    04360 Axon guidance     121464173 (Rhoa)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121464173 (Rhoa)    05206 MicroRNAs in cancer     121464173 (Rhoa)    05205 Proteoglycans in cancer     121464173 (Rhoa)    05203 Viral carcinogenesis     121464173 (Rhoa)   09162 Cancer: specific types    05210 Colorectal cancer     121464173 (Rhoa)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     121464173 (Rhoa)   09171 Infectious disease: bacterial    05132 Salmonella infection     121464173 (Rhoa)    05135 Yersinia infection     121464173 (Rhoa)    05133 Pertussis     121464173 (Rhoa)    05152 Tuberculosis     121464173 (Rhoa)    05100 Bacterial invasion of epithelial cells     121464173 (Rhoa)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121464173 (Rhoa)    05418 Fluid shear stress and atherosclerosis     121464173 (Rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:morg04131]     121464173 (Rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:morg04147]     121464173 (Rhoa)    04031 GTP-binding proteins [BR:morg04031]     121464173 (Rhoa) Membrane trafficking [BR:morg04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     121464173 (Rhoa) Exosome [BR:morg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121464173 (Rhoa)   Exosomal proteins of other body fluids (saliva and urine)    121464173 (Rhoa)   Exosomal proteins of colorectal cancer cells    121464173 (Rhoa)   Exosomal proteins of bladder cancer cells    121464173 (Rhoa) GTP-binding proteins [BR:morg04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     121464173 (Rhoa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  121464173 NCBI-ProteinID:  XP_041532748 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcagaaagaaactggtgattgttggtgatggagcttgtggtaagacgtgc ttgctcatagtcttcagcaaggaccaattcccagaggtttatgtgcccacggtgtttgaa aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctggacaggaagattatgatcgcctgaggcctctctcctacccagacacggatgttata ctgatgtgcttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccagaagtcaagcatttctgtcccaatgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggagttagccaaaatgaagcaggagccggtaaaa cctgaagaaggcagagatatggcaaacagaattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagagaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgcctcattttgtga

DBGET integrated database retrieval system