Microtus oregoni (creeping vole): 121465280 Help Entry 121465280         CDS       T08307                                  Symbol Sod1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism morg  Microtus oregoni (creeping vole) Pathway morg04146   Peroxisome morg04213   Longevity regulating pathway - multiple species morg05012   Parkinson disease morg05014   Amyotrophic lateral sclerosis morg05016   Huntington disease morg05020   Prion disease morg05022   Pathways of neurodegeneration - multiple diseases morg05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:morg00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     121465280 (Sod1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     121465280 (Sod1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     121465280 (Sod1)   09164 Neurodegenerative disease    05012 Parkinson disease     121465280 (Sod1)    05014 Amyotrophic lateral sclerosis     121465280 (Sod1)    05016 Huntington disease     121465280 (Sod1)    05020 Prion disease     121465280 (Sod1)    05022 Pathways of neurodegeneration - multiple diseases     121465280 (Sod1) Enzymes [BR:morg01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      121465280 (Sod1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  121465280 NCBI-ProteinID:  XP_041534422 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MAMKAVCVLKGDGPVKGTIHFEQKASGEPVLVSGQITGLTEGQHGFHVHQFGDNTQGCTS AGPHFNPHSKKHGGPADQERHVGDLGNVTAGKDGVANVSIEDRVISLSGDHSVIGRTMVV HEKEDDLGKGGNDESTKTGNAGSRLACGVIGIAQ NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggcgatgaaggccgtgtgcgtgctgaagggcgacggccctgtgaagggcaccatccac ttcgagcagaaggcaagtggtgaaccagttttggtgtcaggacaaattacaggattgact gaaggccaacatgggttccacgtccatcagtttggagataatacacaaggctgtaccagt gcaggacctcattttaatcctcactccaagaaacatggcggaccagcggatcaagagaga catgtgggagacctgggcaatgtgactgctggaaaggatggtgtggccaatgtgtccatt gaagatcgtgtgatctcactctcaggagaccattccgtcattggtcgaacaatggtggtc cacgagaaagaagatgacttgggcaaaggtggaaatgatgaaagtacaaagactggaaat gccggaagccgtttggcctgtggtgtgattgggattgcccagtaa

DBGET integrated database retrieval system