Microtus oregoni (creeping vole): 121466233 Help Entry 121466233         CDS       T08307                                  Symbol Rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism morg  Microtus oregoni (creeping vole) Pathway morg04137   Mitophagy - animal morg04140   Autophagy - animal morg04144   Endocytosis morg04145   Phagosome morg04148   Efferocytosis morg05132   Salmonella infection morg05146   Amoebiasis morg05152   Tuberculosis Brite KEGG Orthology (KO) [BR:morg00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121466233 (Rab7a)    04145 Phagosome     121466233 (Rab7a)    04140 Autophagy - animal     121466233 (Rab7a)    04137 Mitophagy - animal     121466233 (Rab7a)    04148 Efferocytosis     121466233 (Rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121466233 (Rab7a)    05152 Tuberculosis     121466233 (Rab7a)   09174 Infectious disease: parasitic    05146 Amoebiasis     121466233 (Rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:morg04131]     121466233 (Rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:morg04147]     121466233 (Rab7a)    04031 GTP-binding proteins [BR:morg04031]     121466233 (Rab7a) Membrane trafficking [BR:morg04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     121466233 (Rab7a) Exosome [BR:morg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121466233 (Rab7a)   Exosomal proteins of other body fluids (saliva and urine)    121466233 (Rab7a)   Exosomal proteins of colorectal cancer cells    121466233 (Rab7a)   Exosomal proteins of bladder cancer cells    121466233 (Rab7a) GTP-binding proteins [BR:morg04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     121466233 (Rab7a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  121466233 NCBI-ProteinID:  XP_041535839 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggtcatcatcctgggagattctggtgttgga aagacatcgctcatgaaccagtatgtaaataagaagttcagtaaccagtacaaagccaca ataggagcagactttctgaccaaggaggtgatggtggatgacagacttgtcaccatgcag atctgggacacagctggtcaagaacggttccagtctcttggtgtggccttctacagaggt gcagattgctgtgttctggtgtttgatgtgactgcccccaacacattcaaaacccttgac agctggagagacgaattccttattcaggccagcccccgggatcccgagaacttccccttt gttgtgttgggaaacaagattgaccttgaaaacagacaagtggccacgaagagggcacag gcttggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aatgtggagcaggccttccagacaattgctcggaatgccctcaaacaggaaacagaagtg gagttatacaatgaattccctgaacccatcaaactggacaagaatgaccgggccaaggcc tccgcagagagctgcagctgttga

DBGET integrated database retrieval system