Moraxella sp. K23: MOXK23_00370 Help Entry MOXK23_00370      CDS       T10744                                  Name (GenBank) hypothetical protein   KO K02110   F-type H+-transporting ATPase subunit c Organism morx  Moraxella sp. K23 Pathway morx00190   Oxidative phosphorylation morx01100   Metabolic pathways Module morx_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:morx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     MOXK23_00370  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:morx00194]     MOXK23_00370 Photosynthesis proteins [BR:morx00194]  Photosystem and electron transport system   F-type ATPase [OT]    MOXK23_00370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  BFN00923 LinkDB All DBs Position 46153..46395 Genome browser AA seq 80 aa AA seqDB search MTLEGMTVLAVALLIGLGALGTGIGFAILGGKFLEGVARQPELGSQLQTRMFIVAGLLDA VPMIGVGIAMLLLFANPLAG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgactctagaaggtatgaccgttcttgccgttgctttgctaatcggtttaggtgcacta ggcacaggtattggctttgcaatcttaggtggcaaattcttagagggcgtcgctcgtcaa ccagaactaggttcacaattgcaaactcgtatgttcatcgtggcaggtcttcttgacgcc gtaccgatgatcggtgttggtattgcaatgttattgttattcgcaaatcctttagcaggt taa

DBGET integrated database retrieval system