Moraxella sp. K23: MOXK23_06750 Help Entry MOXK23_06750      CDS       T10744                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism morx  Moraxella sp. K23 Brite KEGG Orthology (KO) [BR:morx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:morx03110]     MOXK23_06750 (grxC) Chaperones and folding catalysts [BR:morx03110]  Protein folding catalysts   Protein disulfide isomerase    MOXK23_06750 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 Thioredoxin_2 Thioredoxin_3 SH3BGR GST_N TXD17-like_Trx Nfu_N Motif Other DBs NCBI-ProteinID:  BFN01561 LinkDB All DBs Position complement(782343..782603) Genome browser AA seq 86 aa AA seqDB search MAMVKIYTTPTCPYCMQAKMLLKNKGQAFEEVNMYDVTTEERQALAQKTNNYRTVPQIFI GDNFIGGYDQLAGLERQGKLDGLLAD NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggctatggtgaaaatttataccacaccgacttgcccctactgtatgcaagctaaaatg ctattaaaaaacaaaggccaagcatttgaagaagttaacatgtatgatgtgaccacagaa gaacgtcaggcattggcgcaaaaaaccaataattatcgcacagtaccgcaaatttttatt ggcgataatttcattggtggttatgaccaactcgctggtcttgagcgtcaaggcaaactt gatggtttattagcggattaa

DBGET integrated database retrieval system