Mycobacterium orygis: MO_001726
Help
Entry
MO_001726 CDS
T09544
Name
(GenBank) ANTAR domain-containing response regulator
KO
K22010
two-component system, response regulator PdtaR
Organism
mory
Mycobacterium orygis
Brite
KEGG Orthology (KO) [BR:
mory00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
mory02022
]
MO_001726
Two-component system [BR:
mory02022
]
Other families
PdtaS-PdtaR
MO_001726
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
ANTAR
Motif
Other DBs
NCBI-ProteinID:
WPF63784
UniProt:
A0AAU0QC14
LinkDB
All DBs
Position
1832172..1832789
Genome browser
AA seq
205 aa
AA seq
DB search
MTGPTTDADAAVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPD
LVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISD
LIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRA
AMDRRTTMKRVAEVVLETLGTPKDT
NT seq
618 nt
NT seq
+upstream
nt +downstream
nt
atgaccggccccaccaccgacgccgatgccgctgtcccacgtcgggtcttgatcgcggaa
gatgaagcgctcatccgcatggacctggccgagatgttgcgagaggagggatatgaaatt
gtcggcgaggccggcgacggccaggaagccgtcgagctggccgagctgcacaagcccgac
ctggtgatcatggacgtgaagatgccgcgtcgggacgggatcgacgccgcatccgaaatc
gccagcaaacgtattgccccgatcgtggtgctgaccgcgttcagccagcgtgatctggtc
gaacgtgcgcgtgatgccggggcgatggcatacctggtaaagcctttcagcatcagcgac
ctgattccagcgattgaattggcggtcagccggttcagggagatcaccgcgttggaaggc
gaggtggcgacgctatctgaacggttggaaacccgcaagctggtggaacgagcaaaaggc
ctgctgcagaccaaacatgggatgaccgagccggacgctttcaagtggattcaacgtgcc
gccatggatcggcgcaccaccatgaagcgggtggccgaagtcgtgctggaaaccctcgga
acacccaaagacacctga
DBGET
integrated database retrieval system