Mycobacterium ostraviense: LTS72_06995 Help Entry LTS72_06995       CDS       T07946                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mot  Mycobacterium ostraviense Pathway mot01100   Metabolic pathways mot01110   Biosynthesis of secondary metabolites Module mot_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mot_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mot00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LTS72_06995    00074 Mycolic acid biosynthesis     LTS72_06995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LTS72_06995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UGT93063 LinkDB All DBs Position complement(1525413..1525670) Genome browser AA seq 85 aa AA seqDB search MTIQQDTRDAVLSVLTTIAPEVDADDIRDDVLLRDQVDLDSMDWLNFLLGIHKRMHVEIP ESDYASLRTLADVVNYVDKHAAKTA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgactatccaacaagacactcgtgacgcggtgctgtccgtgttgaccaccatcgcgcct gaagtcgatgccgacgacattcgcgacgacgtgctgctgcgcgatcaagtcgacctcgat tccatggactggctgaacttcctcctcggcatccacaaacggatgcacgttgagattccg gagtcggactacgcgtctcttcgtaccctcgccgacgtggtgaactacgtcgacaagcac gcggccaagacggcttga

DBGET integrated database retrieval system