Mycoplasma ovis: OVS_02940 Help Entry OVS_02940         CDS       T02962                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism mov  Mycoplasma ovis Brite KEGG Orthology (KO) [BR:mov00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mov03032]     OVS_02940    03036 Chromosome and associated proteins [BR:mov03036]     OVS_02940    03400 DNA repair and recombination proteins [BR:mov03400]     OVS_02940 DNA replication proteins [BR:mov03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     OVS_02940 Chromosome and associated proteins [BR:mov03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     OVS_02940 DNA repair and recombination proteins [BR:mov03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       OVS_02940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AHC40008 LinkDB All DBs Position complement(482989..483276) Genome browser AA seq 95 aa AA seqDB search MNKSELLSAIASSTGLTKDQVNGVLDKYNEIVINKVLEDKEFTVLGLGKVKVVRRAERKA FNPKTKEPIVIPSVDAPKFSFARAVKAKIAEKGGK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaataagtctgaattactttcagcaattgcaagtagtactggtttaactaaggatcaa gttaatggtgttttggacaaatacaatgaaatagttatcaataaggttttagaggacaaa gaatttactgtcttaggattaggaaaagttaaggtagtgagaagagcggaaagaaaagct tttaatcctaaaactaaggaacctattgttattccctcagttgatgctcctaagttttct ttcgcaagagctgttaaagcaaagattgctgaaaagggaggtaaatag

DBGET integrated database retrieval system