Microbacterium oxydans: CVS54_00250
Help
Entry
CVS54_00250 CDS
T06672
Symbol
phnC_1
Name
(GenBank) Phosphate-import ATP-binding protein PhnC
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
moy
Microbacterium oxydans
Pathway
moy02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
moy00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
CVS54_00250 (phnC_1)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
moy02000
]
CVS54_00250 (phnC_1)
Enzymes [BR:
moy01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
CVS54_00250 (phnC_1)
Transporters [BR:
moy02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
CVS54_00250 (phnC_1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
AAA_16
AAA_29
RsgA_GTPase
AAA_22
MMR_HSR1
AAA_33
SMC_N
nSTAND1
NACHT
AAA_28
Ploopntkinase3
FtsK_SpoIIIE
DUF87
ORC-CDC6-like
G-alpha
Motif
Other DBs
NCBI-ProteinID:
AZS38953
UniProt:
A0A3Q9J3A1
LinkDB
All DBs
Position
268837..269781
Genome browser
AA seq
314 aa
AA seq
DB search
MTLPAPRLAPAAAVSAPGRNGDDSSSSGRVADRHAGAPTDALGFGPAEGALRTPTAELRQ
ALPLVTVRGLQVAYGENTVLDGVDLDLFPGEMVALLGASGSGKSTLMRSLTGFAPISSGT
VRVAGHDVTNLGRGELRTLRSGVGQVFQQFNLIPRLSVMTNVLTGALHGAGPINIAGGFS
NVHRRRALELLDRVGIAHKASAPARSLSGGQQQRVAIARALMQLPKVILADEPVASLDPK
LAGSVLGLLREIATQDGIPVLVSLHVLPLALAHSDRIVGLRHGEMLVSGVTSQLDAAALE
DLYDDEEHGDDDDH
NT seq
945 nt
NT seq
+upstream
nt +downstream
nt
gtgactcttcccgctccgcgtctcgcgccggcggccgctgtttccgcacccggccgaaac
ggagatgattcgtcgtcgtcagggcgcgtcgcagaccgacacgccggagcgccaaccgat
gctctgggtttcggccccgccgagggtgccctgcgcacccccacggccgagctccgccag
gcgcttcccctcgtcacggtccgcggactgcaggtcgcgtacggggagaacacggtgctc
gatggggtcgacctcgacctcttccccggcgagatggtcgccctgctcggagcctcgggc
tcggggaaatccacgctgatgcgcagcctgaccgggttcgcgccgatcagctccggcacg
gtccgcgtggccgggcacgacgtcacgaacctcggccgcggcgagctgcgaaccctccgc
tccggggtcggacaggtgttccagcagttcaacctgatcccacgcctcagcgtcatgacc
aatgtgctcaccggcgccctgcacggcgccgggccgatcaacatcgcgggaggcttctcg
aacgtgcaccgccgtcgggcgctcgaactgctcgatcgggtcgggatcgcgcacaaggca
tccgctcccgcacgctccctctcggggggacagcagcagcgtgtggcgatcgcgcgggcg
ctcatgcagctgccgaaagtgatcctggccgacgagccggtcgcgtcactcgatccgaag
ctcgcgggatccgtgctcggcctgttgcgcgagatcgccacgcaggacggcatccctgtg
ctggtgagcctacatgtgctgccgctcgctctcgcgcacagcgaccgcatcgtcgggctt
cgccacggcgagatgctcgtctccggcgtgacctcgcagttggatgccgccgcgctggaa
gacctgtacgacgacgaggagcacggtgatgacgacgaccactga
DBGET
integrated database retrieval system