Methylogaea oryzae: MoryE10_05930 Help Entry MoryE10_05930     CDS       T07433                                  Symbol acpP_1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism moz  Methylogaea oryzae Pathway moz01100   Metabolic pathways moz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:moz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MoryE10_05930 (acpP_1)    00074 Mycolic acid biosynthesis     MoryE10_05930 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MoryE10_05930 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BBL69987 UniProt:  A0A8D4VNW3 LinkDB All DBs Position 609823..610053 Genome browser AA seq 76 aa AA seqDB search MSDVAERVKKIVAEQLGVKEEISNEASFVDDLGADSLDTVELVMALEEEFECEIPDEDAE KITTVQQAIDYVTSHT NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtgacgttgctgaacgtgttaagaagatcgtagccgagcaactcggcgtgaaagag gaaatctccaatgaggcctctttcgtcgacgatctgggcgctgactccctggacacggtg gaattggtgatggcgctggaagaagaattcgaatgcgaaatccccgacgaggacgccgaa aagatcaccaccgtccagcaagccatcgattacgttacgagccacacctaa

DBGET integrated database retrieval system