Methylogaea oryzae: MoryE10_11790 Help Entry MoryE10_11790     CDS       T07433                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism moz  Methylogaea oryzae Pathway moz01100   Metabolic pathways moz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:moz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MoryE10_11790    00074 Mycolic acid biosynthesis     MoryE10_11790   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MoryE10_11790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BBL70573 UniProt:  A0A8D5AGN6 LinkDB All DBs Position complement(1273940..1274194) Genome browser AA seq 84 aa AA seqDB search MKEEILAKVAEYIINAGDLKLKPEEVTENLSLKDDLDLDSVGSLTAIMDLEEHYDIVVED KQLLGLQTVGDVVALIESGLAAKS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaaagaagaaatactggctaaagttgccgaatatattatcaatgccggcgatttaaag cttaagccagaagaggtaacggaaaatttgtcgttgaaggacgacctcgatttggactcc gtcggcagcctcaccgcgattatggacctagaagaacactacgacatcgtggtcgaagac aaacagctgctcggattgcaaaccgtcggcgacgtggtcgccttgatcgagtccggcctc gcggcgaaatcatga

DBGET integrated database retrieval system