Methylogaea oryzae: MoryE10_24400 Help Entry MoryE10_24400     CDS       T07433                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism moz  Methylogaea oryzae Pathway moz01100   Metabolic pathways moz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:moz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MoryE10_24400    00074 Mycolic acid biosynthesis     MoryE10_24400   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MoryE10_24400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBL71834 UniProt:  A0A8D5AKI9 LinkDB All DBs Position complement(2865954..2866217) Genome browser AA seq 87 aa AA seqDB search MPDDLIDQLKSMLIEGLRLEDVAPDDLSPDAALFGGGLGLDSIDALEIGVMLDRQYGIKV SSGDERNHQIFASLRSLAEFVASHRTR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgccggatgatttgatcgaccaattgaaatccatgctgatcgagggcttgcgcctggaa gacgtggcgcccgacgacctgtcccccgacgctgctttgttcggcggcggcctgggcctg gattccatcgacgcgctggaaatcggcgtgatgctggaccgccaatacggcatcaaggtt tcctccggcgacgagcgcaaccaccagattttcgcctccctgcggtcgctggcggagttc gtcgcttcccatcgcacccgctag

DBGET integrated database retrieval system