Methylogaea oryzae: MoryE10_24550 Help Entry MoryE10_24550     CDS       T07433                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism moz  Methylogaea oryzae Pathway moz01100   Metabolic pathways moz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:moz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MoryE10_24550 (acpP_2)    00074 Mycolic acid biosynthesis     MoryE10_24550 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MoryE10_24550 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Rad60-SLD_2 Motif Other DBs NCBI-ProteinID:  BBL71849 UniProt:  A0A8D5AKJ4 LinkDB All DBs Position complement(2878181..2878429) Genome browser AA seq 82 aa AA seqDB search MKTKEEVFSTLRQIMSEMFDLPAEEIALDSSLGQDLDIDSIDAVDLMVKLREITGKRIDP EDFKNARTIQDVVDTVYRITAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaaaaccaaagaagaagtcttttccactttacggcaaatcatgtcggaaatgttcgac ctgccggcggaggaaatcgctttagattcgagcttgggtcaggatttggatatcgacagc atcgacgcggtggacttgatggtgaaactccgggaaatcaccggcaaacgcatcgacccg gaggatttcaaaaacgcccgcaccattcaggacgtggtggatacggtttatcgcatcacc gccgcttaa

DBGET integrated database retrieval system