KEGG   Methylogaea oryzae: MoryE10_31680
Entry
MoryE10_31680     CDS       T07433                                 
Symbol
msbA
Name
(GenBank) lipid A export ATP-binding/permease protein MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
moz  Methylogaea oryzae
Pathway
moz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:moz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MoryE10_31680 (msbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:moz02000]
    MoryE10_31680 (msbA)
Enzymes [BR:moz01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     MoryE10_31680 (msbA)
Transporters [BR:moz02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    MoryE10_31680 (msbA)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 ABC_ATPase AAA_30 NACHT RsgA_GTPase TgpA_N DUF3584 AAA_29 MobB RestrictionSfiI nSTAND3 AAA_19 NB-ARC AAA_33 TsaE KAP_NTPase
Other DBs
NCBI-ProteinID: BBL72562
UniProt: A0A8D4VRU0
LinkDB
Position
complement(3649110..3650882)
AA seq 590 aa
MNDTKAQPPNSLQAYLRLLSYVRPYWLIFSVSLIGFVIYAATQPAFTKLMESAVDYVQNR
KQEEAMWIPLAMVGIMLVRGIGSFLGNYYIAKVANNVVHTLRCRIFDRYTELPTSYFDDN
NSGHLISRVTYNVTQVTTAATDAIKVVVREGMTVIALIGYLAYLNWRLSLIFLAIAPLIA
FVVSRANKRFRKQAKRIQSSMGDVTHISSELITGHRVVRSFGGEDYEKRRFREASRDNYR
QLLSMVKTSAISTPVLQLIVTSALAVLIYLALLMMSDGSAGQFVAFITTAILIPKPLRQL
SEVSSTIQKGITAAESIFEVLDEAPEADHGTLDVERARGRVEFRGLTFGYPASQRPVLDD
VSFVAEPGQTVALVGHSGSGKTTLVNLIPRFYDHHQGQILLDDVDVNQYALKSLRRQIAF
VTQHVTLFNDTVAANIAYGTLGNAPRAAIVEAARQANALEFIERLPDGLDTLIGENGVKL
SGGQRQRLAIARALLKNAPLLILDEATSALDTESEQKIQLALDKAMRGRTTLVIAHRLST
VENADLILVLDQGRIVERGDHAELLALGGIYAQLHRRQFHDAPRPVAEDG
NT seq 1773 nt   +upstreamnt  +downstreamnt
ttgaacgacaccaaagcccagccccccaacagcctgcaagcctatctgcggctgctgtcc
tacgtccggccctactggctgattttctcggtgagcctgatcgggttcgtcatctacgcc
gccacccagcccgccttcaccaagctgatggaaagcgccgtggactacgtgcagaaccgc
aagcaggaagaggccatgtggattcccctggccatggtgggcatcatgctggtgcggggc
atcggttcgttcctgggcaattactacatcgccaaggtggccaacaacgtggtgcacacc
ctgcgttgcaggattttcgaccgctatacggaactgcccaccagctacttcgacgacaac
aactccggccacctcatttcccgcgtcacctacaacgtcacccaggtgactaccgccgcc
accgacgccatcaaagtggtggtgcgggaaggcatgacggtgatcgccctgatcggctac
ctggcctacctcaactggcggctgtcgctgatcttcctcgccatcgcgccgctcatcgct
tttgtcgtgtcccgcgccaacaagcgcttccgcaagcaggccaagcgcattcaaagctcc
atgggcgacgtcacccacatctcgtcggagctgattaccggccaccgggtggtgcgcagc
ttcggcggcgaggactacgaaaagcggcgcttccgcgaagccagccgcgacaactaccgc
cagttgctgagcatggtgaagacctccgccatcagcacgccggtgttgcagctgatcgtc
accagcgccctggcggtattgatctacctggccctgctgatgatgagcgacggcagcgcc
ggccagttcgtcgccttcatcaccaccgccatcctcatccccaagcccctgcgccagttg
agcgaggtcagctccaccatccagaaaggcatcaccgccgccgaaagcattttcgaggta
ctggacgaggcgccggaagcggaccacggcaccctggacgtggagcgggcgcgcggccgg
gtggagttccgcgggctgactttcggctacccggccagccagcggccggtgctggacgac
gtgtctttcgtcgccgaaccgggccagaccgtggccctggtgggccattccggcagcggc
aagaccaccctggtaaacctgatcccgcgcttttacgaccatcaccagggccagatcctg
ttggacgacgtcgacgtcaaccaatatgccctgaagagcttgcgccgccagatcgctttc
gtgacccagcacgtcacgttgttcaacgacacggtcgccgccaacatcgcctacggcacc
ctgggcaacgcgccgcgggcagccatcgtcgaggcggcgcggcaagccaacgccctggaa
ttcatcgagcggctgccggacggcctggacaccctcatcggcgaaaacggcgtcaagctg
tccggcggccaacgccagcggctggccatcgcccgcgccctgctgaaaaacgcgccgctg
ctgatcctggacgaagccacttcggccctggacacggaatcggagcagaaaatccagctg
gccctggacaaagccatgcgcggccgcaccaccctggtgatcgcccaccgcctgtccacg
gtggagaacgccgacctgatcctggtgctggaccaaggccgcatcgtcgagcgcggcgat
cacgccgaactgctggcgctcggcggcatctacgcccaattgcaccggcggcaattccac
gacgcgccgcggccggtagccgaggacgggtaa

DBGET integrated database retrieval system