Methylomonas paludis: KEF85_03090 Help Entry KEF85_03090       CDS       T07508                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mpad  Methylomonas paludis Pathway mpad01100   Metabolic pathways mpad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpad00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KEF85_03090 (acpP)    00074 Mycolic acid biosynthesis     KEF85_03090 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KEF85_03090 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 Motif Other DBs NCBI-ProteinID:  QWF71478 UniProt:  A0A975RAL6 LinkDB All DBs Position 654969..655202 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIVGEQLGVKEEIANDASFVDDLGADSLDTVELVMALEEEFECEIPDEEAE KITTVQLAIDYINANLQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtaatatcgaagaacgagtaaaaaagattgtcggagagcaactaggcgtgaaggaa gaaatcgcaaacgatgcgtcttttgttgacgatcttggtgctgattctttagacacagtc gaactcgtcatggcgctggaagaagaatttgaatgtgaaattccagatgaagaagccgag aaaatcaccacggtgcaactggctattgattatatcaacgccaatttgcaataa

DBGET integrated database retrieval system