KEGG   Mycobacterium pallens: K0O64_27545
Entry
K0O64_27545       CDS       T07675                                 
Name
(GenBank) Rieske 2Fe-2S domain-containing protein
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mpae  Mycobacterium pallens
Pathway
mpae00624  Polycyclic aromatic hydrocarbon degradation
mpae01100  Metabolic pathways
mpae01120  Microbial metabolism in diverse environments
mpae01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpae00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    K0O64_27545
Enzymes [BR:mpae01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     K0O64_27545
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: QYL16692
UniProt: A0A8F9S8C2
LinkDB
Position
complement(5622913..5624289)
AA seq 458 aa
MTTETTETTGTADATDPYLRRALRDVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVF
LGHESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHRGALVCRAEMGNTAHFQC
PYHGWVYSNTGELVGVPAMSEAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTD
YLGDTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELG
MAPGDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMATSYPSPVHKD
LMRRSSFIHGTVFPNLSFINVTLAQDHMSPPTPFITFRVWHPLSHDRMEILSWFLVERDA
PEWLRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGEGLLNYEMGMDLTPLTD
WPGPGEALPSGYAEQNQRRFWGRWLEYMGQPPAFGGRA
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccgaaaccaccggcacagctgacgcgaccgatccctacctgcgg
cgcgcgctgcgcgacgtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtc
agcgatcccgcgctacacacgatcgagatggagcggatcttcgggcgcgcctgggtgttt
ctcggacacgagtcggagttggccaagtccggcgacttcgtcgtgcggcacatcggggcc
gattcggtgatcgtttgccgggacaactccggccgcatccaggcgctgtccaattcttgt
cgccaccgtggtgcgctcgtgtgccgcgctgagatgggaaacaccgcgcacttccaatgc
ccgtaccacggctgggtgtacagcaacaccggagagctcgtcggcgtgccggcgatgagt
gaggcctatcccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtc
gactcgtacgccggattcatcttcggcagcgtcgatccgaaggcgccgagcctgaccgac
tacctcggcgacacgacgttctacctcgacctcattgcgaagaagacagcgggcggtctg
gaggtgataggggcaccgcatcgatgggtgatgtcagcgaactggaagacagccgccgac
aattttgtcggcgactcctaccacaccctctttgctcaccgctcgatggtcgagctaggc
atggcgcccggtgacccaaacttcgcgagcgcaccagcggaaatctcgctgcagaacggc
cacggcgtcggcgtactcggctttccgcccacgctcgccgattttcccgagtacgaggga
taccccgacgaagtcgtcgaccagatggcgacgtcctacccgtcgccggtacacaaggac
ctgatgcgacgctcatcctttattcacggcaccgtgttcccgaatttgtcgttcatcaac
gtgaccctcgcgcaggaccacatgtcgccccctacccccttcatcacgttccgggtatgg
catccgctctcccatgatcggatggagatcctctcctggttcctggtcgaacgcgatgct
ccggaatggttgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccaggtggg
gttttcgaacaggacgacgccgaggcatggaaggccatcaccgaatctgtccagggcccg
ttcgccggtgaaggcctgctgaactacgaaatgggcatggacttgactccgctcaccgac
tggccagggccgggagaggccctcccgagcgggtacgccgagcagaatcagcggcggttt
tgggggagatggctggaatacatgggtcagcctcccgcattcggcgggcgtgcttga

DBGET integrated database retrieval system