Microbulbifer pacificus: R5R33_00785 Help Entry R5R33_00785       CDS       T09537                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mpaf  Microbulbifer pacificus Pathway mpaf01100   Metabolic pathways mpaf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpaf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R5R33_00785 (acpP)    00074 Mycolic acid biosynthesis     R5R33_00785 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R5R33_00785 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 Motif Other DBs NCBI-ProteinID:  WOX05714 UniProt:  A0AAU0N0X3 LinkDB All DBs Position complement(197082..197318) Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVAEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQLAIDYINQNLG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagagcgcgtaaaaaagatcgttgctgaacaactgggcgtgaaggaa gaagatgtaaaacctgaagcatcctttgttgaagatctgggcgctgactccctcgacaca gttgagctggtaatggctttggaagaggaattcgaaactgagattcctgacgaagaagca gaaaaaatcaccactgttcagctggccatcgattacatcaaccagaacctcggttga

DBGET integrated database retrieval system