Mycobacterium paragordonae: C0J29_07615 Help Entry C0J29_07615       CDS       T06847                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mpag  Mycobacterium paragordonae Brite KEGG Orthology (KO) [BR:mpag00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     C0J29_07615 Enzymes [BR:mpag01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      C0J29_07615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_2 GST_N_3 Thioredoxin Glrx-like GST_N SH3BGR Motif Other DBs NCBI-ProteinID:  AYE94663 UniProt:  A0A386U2C5 LinkDB All DBs Position complement(1638492..1638737) Genome browser AA seq 81 aa AA seqDB search MTNAALTMYTTSWCGYCFRLKTALKAQGIAYDEVDIEQDSAAAEFVSSVNGGNRTVPTVK FADGSTMTNPSAGEVKAKLAG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccaatgctgcgctgaccatgtacaccaccagctggtgtggctactgcttccggctc aagacggcgctgaaggctcagggcatcgcctatgacgaggtcgacatcgaacaggattcc gcggccgcggaattcgtcagctccgtcaacggcggcaaccgcacggtgccgaccgtgaag ttcgccgacgggtcgaccatgaccaatccgagcgccggcgaggtcaaggcgaagctcgcg ggctga

DBGET integrated database retrieval system