KEGG   Mycobacterium paragordonae: C0J29_19440
Entry
C0J29_19440       CDS       T06847                                 
Name
(GenBank) ABC transporter ATP-binding protein
  KO
K18888  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C0J29_19440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpag02000]
    C0J29_19440
Transporters [BR:mpag02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    C0J29_19440
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_21 AAA_22 ABC_ATPase AAA_16 AAA_23 SbcC_Walker_B AAA AAA_15 MMR_HSR1 AAA_25 NACHT AAA_30 MobB NB-ARC DUF3584 nSTAND3 AAA_29
Other DBs
NCBI-ProteinID: AYE96638
UniProt: A0ABQ1C7C8
LinkDB
Position
complement(4272600..4274429)
AA seq 609 aa
MRVARRLGPQSRLIAAVAALSVGSIALAVIGPRVLGHATDLLFNGVIGKQLPAGLTKDEA
IQTLRARGDNGFADLVSGMDVVPGRGIDFGAVARTLMIAMVIYLSAALLVWVKGRMLNVI
VQRTILSLRADAEDKLHRLPLSYFDGHQRGELLSRVTNDIDNIETSLWMTINPLLTALLT
VGAVLAMMMSISLLLTAITLLTVPLSLVLIRLIAPRAQRLFDEQWSVIGRLNAHVEETYS
GLALVKTFGQRARAQQRFRDLNSRVYRSNFGAEFLSGLISPATDFVANLNYVVVAVVGGL
KVASGQITLGNIQAFIQYVRQFNQPVVNLASMYYIAQSGVASADRVFALLDASEQQPDRL
STLPPVAESAPRGRVEFERVNFSYRPGVPVIKDLSLVVEAGSSVAIVGRNGCGKTTLVNL
LMRFYEVDSGRILIDGVDIATVSRHSLRSRIGMVLQDSWLLGGTIAENIGYGRPGASRDE
IISAARAACVDRFVDKLPDGYDTMVSDDGGNISGGQKQLITIARAFLARPQLLILDEATS
SVDTRTELLVRQSMRELRRGRTTFVIAHRLSTIRSADLIVVMQAGEIIERGTHAELMARR
GAYYSMTQV
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgcgggtggcgcgtcgcctcgggccgcagtcgcggttgatcgctgcggtggcggcgctg
tcggtcgggagcatcgctcttgcggtgatcggtccgcgcgtcctgggccatgcgaccgat
ctcttgttcaacggcgtgatcgggaaacaattgccggccgggctcaccaaggacgaggcg
atccagacgctgcgggcgcggggcgacaacggcttcgccgatctggtgtcgggtatggac
gtggtacccggccggggcatcgacttcggcgccgtggcacggactttgatgatcgccatg
gtgatttatctgtctgcggcactgctggtttgggtcaagggacggatgttgaacgtcatc
gtgcagcgcaccatcctgtccctgcgtgccgacgcggaagacaagctgcaccgcctccca
ctgtcgtatttcgacggtcatcagcgcggtgagctgctgagccgggtcaccaacgacatc
gacaacatcgagacatcgctgtggatgacgatcaacccgttgctgacggcactgctcacg
gtcggggcggtgctggccatgatgatgtccatttcgctgctgctcaccgcgatcacgttg
ctcaccgtgcccctgtcacttgtgctgatcaggctgatagcgccacgcgcgcaacggttg
ttcgacgagcagtggtcggtcatcgggcggctcaacgctcatgtcgaagagacctacagc
ggactggctctggtcaagacgttcggtcagcgcgcccgggcgcagcagcggttcagagat
ctcaactccagggtctaccgatcgaatttcggtgccgaatttctctccggcttaatctcg
ccggccaccgatttcgttgcgaacctcaactatgtcgtcgtcgcggtggtgggtggactg
aaggtggcgtccggacagatcacgctgggcaacatccaggcgttcattcagtatgtgcgc
cagttcaatcaaccggtcgtcaacctcgcgtcgatgtactacatcgctcagtccggggtg
gccagcgcagaccgcgtcttcgcgctgctggacgcttccgaacagcagcccgaccgcttg
tcgaccctgccgcccgttgccgagtcggcaccacgggggcgggtggagttcgagcgggtc
aatttcagctaccggcccggcgtcccggtgatcaaggacctctcactggtcgtcgaagca
ggcagcagtgtcgccatcgtcggacgcaacgggtgcggcaagaccacgctggtgaacctg
ttgatgcgattctacgaagtcgattccggccggattctgatcgacggcgtcgacatcgca
acggtgagtcggcactcgctgcgctcgcggatcgggatggtgctgcaggacagctggctg
ctcggcggaacgatcgcggagaacatcggctacggacgccctggggcgagtcgcgacgag
atcatctcggcggccagggcggcgtgcgtggaccgcttcgtcgacaagttgcccgacggc
tacgacacgatggtgagtgacgacggtggcaacatcagcggcgggcagaagcagttgatc
acgattgctcgggcattcttggcccgcccgcaactcttgatacttgacgaggcgacgagt
tcggtggatacccgcaccgagttgctggttcggcagtcgatgcgcgagttgcgtcgtgga
cgaaccactttcgttatcgcacaccgactttcgactatccgcagtgccgacctgatcgtc
gtgatgcaggctggggagatcatcgagcgcggcacccatgccgagttgatggcgcggcgg
ggtgcctattactcgatgacgcaggtgtga

DBGET integrated database retrieval system