KEGG   Mus pahari (shrew mouse): 110312788
Entry
110312788         CDS       T05929                                 
Symbol
Spn
Name
(RefSeq) leukosialin
  KO
K06477  sialophorin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312788 (Spn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110312788 (Spn)
CD molecules [BR:mpah04090]
 Proteins
  110312788 (Spn)
SSDB
Motif
Pfam: SIT DUF2567 DUF4577
Other DBs
NCBI-GeneID: 110312788
NCBI-ProteinID: XP_021042333
Ensembl: MGP_PahariEiJ_G0013698
LinkDB
Position
1:complement(96620301..96622302)
AA seq 382 aa
MALLLLLLFGGFWVQVVHPYSLQRTTMLSSIPHIIAPSTSEAWSASPSVSVGPGTVDPKE
AISPWRQTIIPVSSTPLGTTELSSFGTSAGAIMSTPVPETTTSQAVSSMLPELSNVASDP
PVTVANPVTDRTVASTSTSKGASAPPTTVTTSSDEISGPSVATTVSSKTSGPPVTMATGS
LGPSSETHGLPATTAASSVASSSVARGTSVSSTKSFTTSIQEPITTRSPLQGSRGMLLLP
LFIAVMVVLALVALLLLWRQRQKRRTGALTLSGGGKRNGVVDAWAGPARVPDEEATTASG
SGGNKDSGVLETEGSEQRPMLSTFFSRRKSRQGSLVLEELKPGSGPNLKGEEEPLVGSED
EAVETPTSDGPQAKDETAPQSL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggccttgcttcttcttctcctctttgggggattctgggtccaggtggtgcacccatac
agtctgcagaggacaacgatgttatcatctatcccacatatcatagccccaagtacctct
gaagcctggagtgccagcccatcagtctctgtggggccagggacagtggaccctaaggag
gccatcagcccctggaggcagaccataatcccagtttcttcgacacccttgggaactact
gaattgtcttctttcgggacttctgctggtgccatcatgagcacccctgtacctgagact
acaacctctcaggcagtttccagcatgcttccagaactatcaaatgtagccagtgaccct
cctgtcactgtagccaatcctgtgacagacagaactgtggcatctacatctacctctaaa
ggagccagtgcaccccccaccactgtgacaacaagctctgacgagatcagtggaccttct
gtggctacaacagtaagctctaagaccagtggtccccctgtcaccatggctactgggtct
ctggggccctccagtgagacacatggactccctgccaccacagcagccagttctgtggcg
agttccagtgtggcccgtggcacctcagtctccagcacaaagtcattcacgacgtctatc
caagagcccataactaccaggtcgccactccaaggatcaaggggcatgttactgctgccc
ttgtttattgccgtgatggtggttttggccctcgtggcgctactgctgttgtggcgccag
aggcagaagcggaggactggggccctgaccctgagcggaggtggaaaacgaaatggggtg
gtggatgcctgggctgggccagcccgggttcctgatgaagaggccacgaccgcatcaggg
tcagggggcaacaaggactctggggtactggagacagaaggctctgagcagcggcccatg
ctcagtacattcttcagcagacggaaatctcgccagggctctttagtcctagaagagctg
aagcctgggtcaggtcccaacctgaagggggaggaagagccgcttgtgggcagtgaggat
gaagctgtggaaaccccaacttctgacgggccacaagccaaagatgagaccgcacctcaa
tctctatga

DBGET integrated database retrieval system