KEGG   Mus pahari (shrew mouse): 110312855
Entry
110312855         CDS       T05929                                 

Gene name
Iqce
Definition
(RefSeq) IQ domain-containing protein E isoform X1
  KO
K24677  IQ domain-contaning protein E
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110312855 (Iqce)
SSDB
Motif
Pfam: IQ Cob_adeno_trans FAM76 ATG16
Other DBs
NCBI-GeneID: 110312855
NCBI-ProteinID: XP_021042434
Ensembl: MGP_PahariEiJ_G0024525
LinkDB
Position
23
AA seq 778 aa
MSLGTTDLASETGDDSLSAITFESDVESKTKRKSFHKPPSTSPKSPYYSKPRKVTSWRSL
KTAGSMPLSSRMSLTPQKLWLGTSKQGSVAQPPSSTLTSEHAWTHPPSCTPDYLTEAVRA
KRADLRRSGSHGHVSGTSVYREKEDMYDEIIELKKSLHMQKSDVDLMRTKLRRLEEENSR
KDRQIEQLLDPGRGPDFVRTLAEKKPDTGWVITGLKQRIFRLEQQCKEKDNTINKLQMDM
KTTNLEEMRIAMETYYEEIHRLQTLLASSEATGKKPMVEKKLGMKRQKKMSSALLNLTRS
VQELTEENQSLKEDLDRMLSNSPTISKIKGYVDWSKPRLLRRIAELEKKVGSSESPKQST
PELVNPNPLLRSPSNISVQKQPKGEPSTEDLPKVDPCAEQEHLQGTVKSLKEELGALQEQ
LLEKDLEMKQLLQSKMDLEKELEMAREGEKERRKQEQDLREEIEALTKKCQELEEAKKEE
RNSFIAMTHEAHPELHAPSPCSRHSEPDSDNSTGEEGGSQPPDPCSEERREAAIRTLQAQ
WKAYKHKKRKAALDEAATVLQAAFRGHLARSKLVHSKVPDSRTPSLPGLLSPLNQSSPTP
RVQSPDSPAEDSPTQEEAIIVIQSILRGYLAQARFIASCCREIAVSSQRETVSVTPSGSA
SPPSLEASPGATRRELCASEELRETSASEPAPSVPYSAQGGHGDCPSSSSLEAVPSVKDA
MCEERSSSPGSAGPSLAEPSPPGLQPLSPPPVEDICSDDSDDIIFSPFLPRKKSPSPF
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgagcctgggcaccacagatctagcctcggagacgggagatgacagtctgtctgctatt
acctttgaatctgacgttgagtcgaaaacaaaaagaaaaagtttccacaaacctccttcc
acatcaccaaagtcgccctactactccaaacccagaaaagtgacctcctggcgatctctg
aagacagcagggagcatgcctctgagtagcagaatgtccttgaccccacagaagctgtgg
ctgggcacctccaaacagggtagtgtggcccaacccccgagctccacgcttacctcggag
cacgcatggacccacccccccagctgcactcccgactacctgacggaagccgtgagagcg
aagagggcagacctcaggcgttccggcagccatggtcacgtctctgggacttcagtctac
agagagaaagaggacatgtacgatgagatcatcgagttgaagaagtccttacatatgcag
aaaagtgatgtggatctgatgagaacaaaacttcggcgcttggaagaggagaacagcaga
aaggatcggcagatagaacagcttctggatccaggtcgaggcccagacttcgtgcgaacc
ttggcagagaagaagcctgacacgggctgggtcatcaccgggctcaagcaaaggatcttc
aggctggagcagcagtgcaaggagaaggacaacactatcaacaaactgcagatggacatg
aagaccaccaacctggaagagatgcgcattgccatggaaacatactacgaagagatccat
cgtctgcagaccctcctggcgagttccgaagccacaggaaagaagcccatggtggagaag
aagctgggtatgaagaggcagaagaagatgagcagtgccctgctgaacctgacgcggagc
gtgcaggagctgaccgaggaaaaccagagcctgaaggaggacctggaccgcatgctgagc
aattcgcccaccatctccaaaataaagggttacgtggactggagcaagccccggctgctg
agacgcatcgcagagctagaaaagaaagtgggctcctcagaaagcccaaagcagtctact
ccagagctggtcaatcccaatcccctgctccgctccccatccaacatctcagtgcaaaag
cagccgaaaggggagccgtccacggaggacctacccaaggtggacccgtgtgcggagcaa
gagcatctccaaggaaccgtgaagagcctgaaagaggagctgggcgcactgcaggagcag
ctgctggagaaagacctggagatgaagcagctgctgcagtccaagatggacctggagaag
gagttggagatggccagggaaggcgagaaggagagacggaagcaggagcaggatttgagg
gaggaaattgaagcgctcaccaaaaagtgtcaagaactggaagaagctaagaaagaagag
agaaactccttcatagcaatgactcatgaggctcacccagagctccatgccccctctccc
tgcagcaggcactccgagccagactccgataacagtactggtgaggagggaggctcccaa
ccccctgacccatgctccgaagagaggagagaggctgccatcaggaccctgcaggcccag
tggaaggcctacaagcacaagaaaagaaaagcagctttggatgaggcagccactgtgctc
caggcagccttcaggggacacctagctcgttcgaagcttgtacacagcaaagtcccagac
tccaggactcccagcctgccaggccttctcagccctcttaaccagagttctcctacaccc
cgagtccaaagccccgactccccggctgaagacagcccaacacaagaggaggccatcatc
gtcatccagtccatcctccgtggatacctggcccaggccaggttcattgccagctgctgt
cgagagattgcggtgtcctctcagagggaaactgtttcagtgacaccctcaggttccgcc
tccccaccctcgctcgaagcttctccaggagcgacacgcagggagctctgtgcctcagag
gaactgagggagacctctgcatctgaacctgccccctccgtcccctactccgcccaaggt
ggccacggggactgcccgtcctcatccagtctggaggctgtgcccagtgtgaaggatgcc
atgtgtgaggaaaggagcagcagccctggaagcgcagggccatccctggctgagccctct
cccccaggactgcagcccttgtcaccaccacctgtggaggacatctgctcagatgactca
gatgacattatcttttcgccatttctgcccaggaagaaaagcccctccccattctag

DBGET integrated database retrieval system