KEGG   Mus pahari (shrew mouse): 110313083
Entry
110313083         CDS       T05929                                 
Symbol
Selplg
Name
(RefSeq) P-selectin glycoprotein ligand 1 isoform X1
  KO
K06544  selectin P ligand
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04613  Neutrophil extracellular trap formation
mpah05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110313083 (Selplg)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110313083 (Selplg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110313083 (Selplg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110313083 (Selplg)
CD molecules [BR:mpah04090]
 Proteins
  110313083 (Selplg)
SSDB
Motif
Pfam: DUF4689 Cadherin_C_2
Other DBs
NCBI-GeneID: 110313083
NCBI-ProteinID: XP_021042781
Ensembl: MGP_PahariEiJ_G0024165
LinkDB
Position
23:complement(3677192..3687910)
AA seq 375 aa
MFLSFLVLLTILGSGNSLPLRDSWEQETTEAPGPVHLRERRQTVEDDDLEDPDYMYNTDP
PELLKNVTNTVAAHPELLTTVVMLERVSVSIGTSETATLKVATTGPAGPGTGGPAVGMLS
TDSATQWSLTTTETIPPTSTEAETSQPTPTEAETSQPTPTEAETSQPTPTEAETSQPTPT
EAETSQSTPTEAETSQSTPTEAETTQLPRIRAVKSLFTTSAATEAPSTEPTTMEMASPES
NESAIFLGPSVTHLPDSGLKKGLIVTPGSSRAPPGSSDLIPVKQCLLIILILASLATIFL
VCTVVLAVRLSRKTHMYPVRNYSPTEMICISSLLPEGGDGAPVTANGGLPKVQDLKTEPS
GDRDGDDLTLHSFLP
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgttcctaagcttccttgtgctgctgactatcttgggctctggcaacagccttccgctg
cgggactcctgggagcaggaaaccacggaagccccggggcctgtgcatctccgggaacgg
aggcagacggttgaggatgacgatttggaggaccctgactatatgtataacacagatccc
ccagagttgctgaaaaatgtcaccaacaccgtggctgctcaccccgagctgctgaccacc
gtggtcatgctagagagagtttccgtgagcattggaacctctgagacagccactttgaag
gttgccaccactggccctgctggcccaggtacaggagggccagctgttgggatgctgagc
acagactctgccacacagtggagtctaaccacaacggagaccatcccaccaacatccaca
gaggcggagacctcgcagccaacacccacggaggcggagacctcgcagccaacacccacg
gaggcggagacctcgcagccaacacccacagaggcggagacctcgcagccaacacccacg
gaggcggagacctcgcagtcaacacccacagaggcggagacctcgcagtcaacacccaca
gaggcagagaccacccagcttcccaggattcgggctgtaaaaagtctgtttacaacgtct
gcagccaccgaagccccttccacagaacctaccaccatggagatggcgtccccagagtct
aacgagtctgccatcttccttgggccatccgtgactcacttacctgacagcggcctgaag
aaagggctgattgtgacccctgggagttcgcgggccccgccagggagttcagacctcatc
ccggtgaagcaatgcctgctgatcatcctcatcttagcttctctggccaccatcttcctc
gtgtgcacagtggtgctggcggtccgtctgtcccgtaagacccacatgtacccagtgcgg
aactactcccccacagagatgatctgcatctcgtccctgctacctgaggggggtgatggg
gcccctgtcacggccaatgggggcctgcccaaggtccaggacctgaagacagagcccagt
ggggaccgggatggggatgacctcaccctgcacagcttcctcccttaa

DBGET integrated database retrieval system