KEGG   Mus pahari (shrew mouse): 110313446
Entry
110313446         CDS       T05929                                 
Symbol
L1cam
Name
(RefSeq) neural cell adhesion molecule L1 isoform X1
  KO
K06550  L1 cell adhesion molecule
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04360  Axon guidance
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110313446 (L1cam)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110313446 (L1cam)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110313446 (L1cam)
   04090 CD molecules [BR:mpah04090]
    110313446 (L1cam)
   04091 Lectins [BR:mpah04091]
    110313446 (L1cam)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  L1 family
   110313446 (L1cam)
CD molecules [BR:mpah04090]
 Proteins
  110313446 (L1cam)
Lectins [BR:mpah04091]
 I-type lectins (Siglecs)
  110313446 (L1cam)
SSDB
Motif
Pfam: Ig_3 I-set fn3 ig Ig_2 Bravo_FIGEY V-set Ig_5 C2-set_2 Ig_C17orf99 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 110313446
NCBI-ProteinID: XP_021043332
Ensembl: MGP_PahariEiJ_G0031706
LinkDB
Position
X:complement(62458316..62485290)
AA seq 1259 aa
MVVMLRYVWPLLLCSPCLLIQIPDEYKGHHVLEPPVITEQSPRRLVVFPTDDISLKCEAR
GRPQVEFRWTKDGIHFKPKEELGVVVHEAPYSGSFTIEGNNSFAQRFQGIYRCYASNKLG
TAMSHEIQLVAEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAAPLRIYWMNSKILHIKQ
DERVSMGQNGDLYFANVLTSDNHSDYICNAHFPGTRTIIQKEPIDLRVKPTNSMIDRKPR
LLFPTNSSSHLVALQGQSLILECIAEGFPTPTIKWLHPSDPMPTDRVIYQNHNKTLQLLN
VGEEDDGEYTCLAENSLGSARHVYYVTVEAAPYWLQKPQSHLYGPGETARLDCQVQGRPQ
PEITWRINGMSMEKVNKDQKYRIEQGSLILSNVQPSDTMVTQCEARNQHGLLLANAYIYV
VQLPARILTKDNQTYMAVEGSTAYLLCKAFGAPVPSVQWLDEEGTTVLQDERFFPYANGT
LSIRDLQANDTGRYFCQAANDQNNVTILANLQVKEATQITQGPRSAIEKKGARVTFTCQA
SFDPSLQASITWRGDGRDLQERGDSDKYFIEDGQLVIQSLDYSDQGNYSCVASTELDEVE
SRAQLLVVGSPGPVPYLELSDRHLLKQSQVHLSWSPAEDHNSPIEKYDIEFEDKEMAPEK
WFSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNPVDV
RGEGNETNNMVITWKPLRWMDWNAPQIQYRVQWRPQGKQETWREQTVSDPFLVVSNTSTF
VPYEIKVQAVNNQGKGPEPQVTIGYSGEDYPQVSPELEDITIFNSSTVLVRWRPVDLAQV
KGHLRGYNVTYWWKGSQRKHSKRHVHKSHIVVPANTTSAILSGLRPYSSYHVEVQAFNGR
GLGPASEWTFSTPEGVPGHPEALHLECQSDTSLLLHWQPPLSHNGVLTGYLLSYHPLAGE
SKEQLFFNLSDPELRTHNLTNLNPDLQYRFQLQATTQQGPGEAIVREGGTMALFGKPDFG
NISATAGENYSVVSWVPQEGQCNFRFHILFKALPEGKVSPDHQPQPQDVSYNQSSYTQWN
LQPDTKYEIHLMKEKVLLHHLAVKTNGTGPVQVSTTGSFASEGWFIAFVSAIILLLLILL
ILCFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGSSQPSLNGD
IKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE
NT seq 3780 nt   +upstreamnt  +downstreamnt
atggtcgttatgctgcggtatgtgtggcctctcctcctctgcagcccctgcctgctcata
cagattcctgatgaatataaaggacaccatgtgctagagccacctgtcatcacagaacag
tctccacggcgcctggttgtcttcccaacagatgacataagcctgaaatgtgaagccaga
ggcagaccccaagtggagttccgctggacgaaagatggcatccacttcaaacccaaggaa
gaattgggtgtagtggtgcatgaggcaccctattctggctccttcaccatcgaaggcaac
aacagctttgcccagaggtttcagggcatctatcgctgctatgccagcaataagctagga
actgccatgtcgcatgagatccagctcgtggccgagggtgcccccaagtggccgaaggag
actgtaaaacctgtggaagtggaggaaggagaatcagtagttctgccttgcaaccctcca
cccagtgcagccccacttaggatctactggatgaacagcaagattttgcacatcaaacaa
gatgagcgggtgtccatgggccagaatggagacctatattttgccaatgtgcttacctcg
gacaatcattcagactacatctgcaatgcccacttccctggtacccggaccatcattcaa
aaggaacctattgacctccgggtcaagcccaccaacagcatgattgaccggaagccacgt
ctgctctttcccacaaactccagcagccacctggtagccttgcagggccagtcattgatc
ctggagtgcattgctgagggattccctacacccaccattaagtggctgcaccccagtgac
ccgatgccaacagaccgtgttatctaccaaaaccacaacaagaccctgcaactactcaat
gtgggcgaagaggacgatggcgagtatacttgccttgctgagaactcgctgggcagtgcc
cggcatgtctactatgttactgtggaagctgccccatactggctgcagaagccccagagc
catttgtatggtccaggagagactgcccgcctagactgccaagtccagggcaggccccaa
ccagagatcacttggagaatcaacggaatgtctatggagaaggtgaacaaggaccagaag
taccggattgagcaggggtctctgatcttgagtaatgtgcagccaagtgacacaatggtg
acccagtgtgaagcccgcaaccagcatgggctcctgctagccaatgcctacatttatgtt
gtccagctgccagccaggatcctaacaaaagacaatcagacatacatggcagttgagggc
agtactgcttacttgctatgcaaagcctttggagctcccgttcccagtgtccagtggctg
gatgaagaaggaaccacagtgcttcaggatgaacgatttttcccctatgccaatggaacg
ctgagcatcagagacctccaggccaatgacactggacgctatttctgccaggctgccaat
gaccagaacaatgtgaccattttggctaacctacaggttaaagaagcaacccagatcaca
caggggccccggagcgcaattgagaagaaaggtgcaagggtgacattcacgtgccaggcc
tcctttgacccctctctgcaggccagcatcacttggcgtggagatgggagagacctccag
gaacgtggggacagtgacaagtatttcatagaagatggacaactggtcatccagagcctg
gactacagtgaccagggcaactacagttgtgtggccagcactgaattggatgaggtggag
agcagggcacagctcttagtggtgggaagccctgggccagtgccttacctggagctgtcc
gaccgccacctgctgaagcagagccaggtgcacttgtcttggagccctgctgaagaccac
aactctcccattgagaaatatgacattgaatttgaggacaaggaaatggctcctgagaaa
tggttcagtctgggcaaggtgccaggaaatcagacctctactaccctcaagctgtccccc
tatgtccactacacctttcgggtcactgccattaacaaatatggtcctggagaacccagc
cctgtctctgagactgtagtcacacctgaggcagctccagagaagaaccctgtggatgtg
agaggggaagggaatgagaccaacaatatggtcatcacatggaagccccttcggtggatg
gattggaatgccccccagattcagtaccgtgtacagtggcgtccacagggcaagcaggag
acctggagggaacagaccgtgagcgaccctttcctggtggtgtctaatacttccacattt
gtgccttatgagatcaaagtccaggcagtgaacaaccagggcaagggccctgagccccag
gtcaccattggctattcaggggaagactacccccaggtgagccctgaacttgaagacatc
acaatcttcaactcaagtactgtgcttgtcaggtggaggcctgtggacttggcccaggtt
aagggccacctcaggggatacaatgtaacatactggtggaagggcagccagagaaagcac
agcaagaggcatgtccacaaaagccacatagtggtacctgcaaacaccaccagtgccatc
ctcagtggtttgcgtccttacagctcttaccatgtggaggtacaggcctttaatgggcgg
ggcttggggcctgcaagtgaatggaccttcagcaccccagagggagtgcctggccaccct
gaggcattacacctggagtgtcagtcggacactagcctgctactgcactggcagccacca
ctcagccacaatggagtgctcactggctacctgctctcttaccatcccttggctggggaa
agcaaagagcagctgttcttcaacctttcggacccagaactccggactcataatctgacc
aacctcaaccctgatctgcagtaccgtttccagcttcaggccaccacccaacagggtcct
ggtgaggctatcgtgcgtgaaggaggcaccatggccctgtttggcaagccagattttggc
aacatctcagccacagcaggtgaaaactacagtgtggtctcctgggtccctcaggagggc
cagtgcaatttcaggttccatatcttgttcaaagccttgccagaagggaaagtgagccct
gatcaccagcctcagcctcaggatgtcagctacaatcagagctcctacacacaatggaac
ctacagcctgacaccaaatatgagatccacctgatgaaggagaaggtcctcctgcaccat
ctggctgtgaagactaatggcactggccccgtgcaagtttctactacaggtagctttgcc
tccgagggctggttcattgcctttgtcagcgctatcattctcttgctcctcatcctgctc
atcctctgcttcatcaaacgcagcaagggtggcaaatactcagtgaaggacaaggaggac
actcaggtagattccgaggcccggcccatgaaagacgagaccttcggcgagtacaggtcc
ctggagagtgacaatgaagagaaggcctttggcagcagccagccatctctcaatggagac
atcaaacccctaggcagtgatgacagcctggctgattatgggggcagtgtggacgtccag
ttcaatgaggatggctccttcatcggccagtacagtggcaaaaaagagaaggaggcagca
ggaggcaatgacagttcaggggctacctctcctatcaatcctgcagtagccctagaatag

DBGET integrated database retrieval system