KEGG   Mus pahari (shrew mouse): 110313611
Entry
110313611         CDS       T05929                                 
Symbol
F8
Name
(RefSeq) coagulation factor VIII isoform X1
  KO
K03899  coagulation factor VIII
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110313611 (F8)
SSDB
Motif
Pfam: F5_F8_type_C Cu-oxidase_3 Cu-oxidase_2
Other DBs
NCBI-GeneID: 110313611
NCBI-ProteinID: XP_021043705
Ensembl: MGP_PahariEiJ_G0031738
LinkDB
Position
X:complement(63760257..63955510)
AA seq 2317 aa
MQIALFACFFLSFFNFCSSAIRRYYLGAVELSWNYIQSDLLNVVHSDSRFLPRMSTSFPF
NTSIMYKKTVFVEYTDQLFKIAKPRPPWMGLLGPTIWTEVHDTVVITLKNMASHPVSLHA
VGVSYWKASEGDEYEDQTSQMEKEDDKVFPGESHTYVWQVLKENGPMASDPPCLTYSYLS
HVDLVKDLNSGLIGALLVCKEGSLSKERTQMLYQFVLLFAVFDEGKSWHSETNDSYTQSM
DSASAGAWPKMHTVNGYVNRSLPGLIGCHKKSVYWHVIGMGTTPEIHSIFLEGHTFFVRN
HRQASLEISPITFLTAQTLLIDLGQFLLFCHISSHKHDGMEAYVKVDSCPEESQWPKKNS
NEEMEDYDDDLYSEMDMFTLDYDSSPFIQIRSAAKKYPKTWIHYISAEEEDWDYAPSVPT
SDNGSYKSQYLSNGPHRIGRKYKKVRFIAYTDETFKTRETIQHESGLLGPLLYGEVGDTL
LIIFKNQASRPYNIYPHGITDVSPLHARRLPRGIKHVKHLPIHPGEIFKYKWTVTVEDGP
TKSDPRCLTRYYSSFINPERDLASGLIGPLLICYKESVDQRGNQMMSDKRNVILFSIFDE
NQSWYITENMQRFLPNAAKTQPQDPGFQASNIMHSINGYVFDSLELTVCLHEVAYWYILS
VGAQTDFLSIFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWVLGCHNSDFRKRG
MTALLKVSSCDKSTSDYYEEVYEDIPTQLVNENNVIDPRSFFQNPNHPNTRKKKFKDTTI
PKNDMEKNEPQFGEIAEMLKVQSVSASDMLMLLGQSHPTPHGLFLSDGQEAIYEAIHDDH
SPNTVDSNEGPSKVAQLRPESHHSEKIVFTPQPSLQLRANKSLETTIEVKWKKLGLQVSS
LPSNLMTTTILSDNLKATFEKTNSSGFPDMPVHSSTKLSTTAFGKKAYPLVGSHVPLRIS
EENSDSNLLDSILMYSQESLPRDNILSMENDRLLREKRFHGIALLTKDNTLFKDNVSLMK
TNKTYNHSTTNEKLHTENPTSTGNSTADMQDAILKVNSEIQEVTALIHGGTLLGKNTTYL
RLNHMLNRTTSAKNKDIFHKKDEDPVPQDEEITIMPLSKMLFLSESANWFKKTNGNNSLN
SEQEHSPKQLVYLMLKKYVKNQSFLSEKNKVIEQNGFTKNIGLKDMVFPRNMSIFLTTLS
KLLENGGHNQEKNIQEEIEKEALIEEKVVLPQVHIAIGSKNFLKDILLLGTRQNISLYEV
HEPILQNITSINNSTNTVQIHMVHFFKRRKNKETNSESLVNKTREMVKNYPSQKNIITQR
SKRALEQFRLSTQWLKTINCSTQCIIKQIDHSKEMKMFIIKSPLSDSSVIKSATQTNSSD
SHILKTSAFPPTDLKRIPFQNKFSHVQASSYIYDFKTKSSRIQESNHFLKETKINNPSLA
ILPWKMFIDQGQFTSPGKSNTNSVTYKKVENIIFLKPILPEESGKIELLPQVSIQDEELL
PTETSHESPGHLNLMKEVFLQKIQGPTKWNKAKGHGESIKGKTEISKKTRSKLLNHHAWD
YHYAAQIPKDMWKSKEKSPEIISIKQEDTILSLRPHGNNHSIGANEKQNWPKREATWVKQ
GQAPRTCSQNLPVLKRHQRELSAFQSEQEATDYDAITIETNEDFDIYSEDIKSGPRSFQQ
KTRHYFIAAVERLWDYGMSTSHVLRNRGQSGNVPQFKKVVFQEFTDGSFSQPLYRGELNE
HLGLLGPYIRAEVEDNIMVTFKNQASRPYSFYSSLISYKEDQRGEELRRNFVKPNETKIY
FWKVQHHMAPTEDEFDCKAWAYFSDVDLERDMHSGLIGPLLICHTNTLNPAHGRQVSVQE
FALLFTIFDETKSWYFTENVERNCKTPCNFQMEDPTLKENYRFHAINGYVMDTLPGLVMA
QDQRIRWYLLSMGNNENIQSIHFSGHVFTVRKKEEYKMAVYNLYPGVFETLEMIPSRAGI
WRVECLIGEHLQAGMSTLFLVYSKQCQIPLGMASGSIRDFQITASGHYGQWAPNLARLHY
SGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKISSLYISQYIIMYSLDGKKWLSY
RGNSTGTLMVFFGNVDSSGIKHNSFNPPIIARYIRLHPTHSSIRSTLRMELMGCDLNSCS
IPLGMESKVISDTQITASSYFTNMFATWSPSQARLHLQGRTNAWRPQVNDPKEWLQVDLQ
KTMKVTGIITQGVKSLFTSMFVKEFLISSSQDGHHWTQILYNGKVKVFQGNRDSSTPMVN
SLDPPLLTRYLRIHPQIWEHQIALRLEILGCEAQQQY
NT seq 6954 nt   +upstreamnt  +downstreamnt
atgcaaatagcactctttgcttgcttctttctgagctttttcaatttctgctctagtgcc
atcagaagatactaccttggtgcagtggaattgtcctggaactatattcagagtgatctg
ctcaatgtggtgcattcagactcaagatttcttcctagaatgtcaacatcttttccattc
aacacctccatcatgtataaaaagactgtgtttgtagagtacacggaccagcttttcaaa
attgccaagcccaggccaccctggatgggtcttctaggtcctaccatttggactgaggtt
catgacactgtggtcattacacttaaaaacatggcttctcatcctgtcagtcttcatgct
gttggtgtgtcctattggaaagcttctgagggagatgaatatgaggatcagacaagccaa
atggagaaggaagatgataaagtttttcctggtgaaagtcatacttatgtttggcaagtc
ctgaaagagaatggtccaatggcctctgaccctccatgtctcacatactcatatctgtct
catgtggatctggtgaaagatttgaattcaggcctcattggagctctgctagtatgtaaa
gaaggcagtctctccaaagaaagaacacagatgttgtaccaatttgtactactttttgct
gtattcgatgaagggaagagctggcactcagaaacaaacgactcttatacacagtctatg
gattcagcatctgctggagcctggcctaaaatgcacacagtaaatggctatgtaaacagg
tctcttccaggtctgattggatgccataagaaatcagtctactggcacgtgattggaatg
ggcaccactcctgaaatacactcaatattcctcgaaggtcacacattttttgtgaggaac
caccgtcaagcttcattggagatatcaccaataactttccttactgctcaaacactcttg
atagatcttgggcagttcctgctattttgtcatatctcttcccataaacatgatggcatg
gaagcttatgtcaaagtagatagctgccctgaggaatcccaatggccaaagaaaaacagt
aatgaggaaatggaagattatgatgatgatctttattcagaaatggatatgttcacattg
gattatgacagctctccttttatccaaattcgttcggctgctaaaaagtaccctaaaact
tggatacattatatttctgctgaggaggaagactgggactatgcaccttcagttcctacc
tccgataatggaagttataaaagccagtatctgagcaatggtcctcatcggattggtagg
aaatataaaaaagttagatttatagcatacacagatgaaacctttaagactcgtgaaact
attcagcatgaatcaggactcttgggacctttactttatggagaagttggagacacactg
ttgattatatttaagaatcaagcaagccggccatataacatttaccctcatggaatcact
gatgtcagtcctcttcatgcaaggagattgccaagaggtataaagcatgtgaagcatttg
ccaattcatccaggagagatattcaagtacaagtggacagttacagtagaagatggacca
actaaatcagatccacggtgcctgacccgctattattcaagtttcattaaccctgagaga
gatctagcttcaggactgattggccctcttctcatctgctacaaagaatctgtagatcaa
aggggaaaccagatgatgtcagacaagagaaatgtcatcctgttttctatatttgatgag
aaccaaagctggtacatcacagagaacatgcaacgattcctccccaatgcagctaaaaca
cagccccaggaccctgggttccaggcctccaacatcatgcacagcatcaatggctatgtt
tttgatagcttggagttgacagtttgtttgcatgaggtggcgtactggtacattctcagt
gttggagcacagacagacttcttatctatcttcttctctggatatactttcaaacacaaa
atggtctacgaagatacacttaccctgttcccattctcaggagaaactgtctttatgtcg
atggaaaatccaggtctatgggtcttggggtgtcataattcagactttcggaagagaggt
atgacagcattgctgaaagtttctagttgtgacaagagcactagtgattattatgaagaa
gtatatgaagatattccaacacagttggtgaatgagaacaatgtcattgatcccagaagc
ttcttccagaatccaaatcatcctaatactaggaaaaagaaattcaaagataccacaatt
ccaaaaaatgatatggagaagaatgagcctcagtttggagagatagcagagatgcttaaa
gtacaaagtgtctcggctagtgacatgttgatgctcttgggacagagtcatcctactcca
catggcttatttttatcagatggccaagaagccatctatgaggctattcatgatgatcat
tcacccaatacagtagacagcaatgaaggcccatctaaagtggcccaactcaggccagaa
tcccatcacagtgagaaaatagtatttactcctcagcccagcctccagttaagagccaat
aaaagtttggagacaactatagaagtaaagtggaagaaacttggtttgcaagtttctagt
ttgccaagtaatctaatgaccacaacaattctgtcagataatttgaaagcaacttttgaa
aagacaaattcttcaggatttccagatatgccagttcactctagtactaaattaagtact
actgcatttggtaagaaagcatatccccttgttgggtctcatgtacctttacgcattagt
gaagaaaatagtgattccaacttgttggattcaattttaatgtatagtcaagaaagttta
ccaagagataatatattatcaatggagaatgatagattactcagagagaagaggtttcat
ggaattgctttattgaccaaagataatactttattcaaagacaatgtctccttaatgaaa
acaaacaagacatataatcattcaacaactaatgaaaaactacacactgagaacccaaca
tcaactgggaatagtacagcagacatgcaagatgccatattaaaggtcaatagtgagatt
caagaagtaacagctttgattcatggtggaacacttttagggaaaaatactacgtatttg
agactaaaccatatgctaaatagaactacctcagcaaaaaataaagacatatttcataaa
aaagatgaagatcctgttccacaagatgaagagattacaatcatgccactttccaagatg
ctgttcttgtcagaatctgcaaattggtttaaaaagaccaatggaaataattccttgaac
tctgagcaagaacatagtccaaagcaattagtatatttaatgcttaaaaagtatgtgaaa
aatcaaagtttcttgtcagagaaaaataaagtgatagaacagaatggatttacaaagaac
ataggacttaaagacatggtttttccacgtaatatgagcatatttcttaccactttgtct
aagttacttgaaaatggtgggcataatcaagaaaaaaatattcaggaagagatagagaag
gaagcactaatcgaagagaaagtagttttgccccaggtgcacatagcaattggctctaag
aatttcttgaaagacatactgttactaggcactaggcaaaatataagtttatatgaagta
catgaaccaatacttcaaaacatcacatcaataaacaactcaacaaatacagtacagatt
cacatggtgcatttctttaaaagaaggaagaacaaggaaacaaattcagaaagcttggta
aataaaaccagagaaatggtaaaaaactatccaagccagaagaatattattactcaacgt
agtaaacgggctttggaacaattcagactgtcaactcaatggcttaaaaccataaactgt
tcaacacagtgtatcattaaacagatagaccacagcaaggaaatgaaaatgttcattatt
aaatctcccttatcagattcttctgtgattaaaagcgccactcagacaaatagttctgac
tcacacattttaaaaacatcagcatttccaccaacagatctcaaaaggattccattccaa
aataaattttctcatgttcaagcatcatcctacatttatgactttaagacaaaaagttca
agaattcaagaaagcaatcatttcttaaaagaaaccaaaataaataacccttctttagcc
attctaccatggaagatgttcatagatcaaggacaatttacttccccaggaaaaagtaac
acaaactcagtcacatataagaaagttgagaacattattttcttgaaaccaattttgcct
gaagaatctggcaaaattgaattgcttcctcaagtttccattcaagatgaagaactttta
cctacagaaactagccatgaatctcctgggcacttgaatctcatgaaagaggtctttctt
cagaaaatacaggggcctactaaatggaataaagcaaaggggcatggggaaagtataaaa
ggtaaaacagagatctctaaaaagactcgctcaaaactgctaaatcatcatgcttgggat
tatcattatgctgcacagataccaaaagatatgtggaaatccaaagagaagtcaccagaa
attatatccattaagcaagaggacacaattttgtctctgaggcctcatggaaacaatcat
tcaataggggcaaatgagaaacaaaattggcccaaaagagaagccacttgggtaaagcaa
ggccaggctccaaggacatgctctcaaaacctaccagtgttgaaacgacatcaaagggaa
cttagtgcttttcaatcagaacaagaagcaaccgactatgatgccatcaccattgaaaca
aatgaggattttgacatttacagtgaggacataaagtcaggtccccgcagctttcaacag
aaaacaaggcactattttattgcagctgtggaacggctctgggactatgggatgagtaca
tctcatgttctacgaaataggggtcaaagtggcaatgtacctcagttcaagaaagtagtt
ttccaggaatttactgatgggtcctttagtcagcccttataccgtggagaattaaatgaa
cacctagggttgttgggcccatatataagagcagaagttgaagacaacattatggtaact
ttcaaaaaccaggcctcccgtccctattccttctattctagcctcatttcttataaggaa
gatcagagaggagaagaacttagaagaaactttgtcaagcctaatgaaaccaaaatttat
ttttggaaagtacaacatcatatggcacccacagaagatgagtttgactgcaaggcctgg
gcttatttctctgatgttgatcttgaaagagatatgcactcaggattaattggacccctt
ctgatttgccacacgaacacactgaatcctgctcatgggagacaagtgtcagttcaggaa
tttgctctgcttttcactatctttgatgagactaagagctggtacttcactgaaaatgtg
gaaaggaactgcaagacaccctgcaatttccagatggaagaccccactttgaaagagaat
tatcgcttccatgcaatcaatggttatgtaatggataccctaccaggcttagtaatggct
caagaccaaaggattcgatggtatcttctcagcatgggcaacaatgagaacatccaatct
attcatttcagtggacatgtttttactgtacggaaaaaagaggagtataaaatggcagtg
tacaacctctacccaggtgtttttgagacactggaaatgataccatccagagctggaatt
tggcgagtagaatgccttattggcgagcacttacaggctgggatgagcactctttttctg
gtgtacagcaagcagtgtcagattcctcttggaatggcttctggaagcatccgtgatttc
cagattacagcttcaggacactatggacagtgggccccaaacctggcaagacttcattat
tccggatcaatcaatgcctggagtaccaaggaacccttttcttggatcaaggtagatctg
ttggctccaatgattattcatggcatcaagactcagggtgctcgtcagaaaatttccagc
ctttatatctctcaatatatcatcatgtatagcctggatggaaagaagtggctgagttat
cgaggaaattccactggaaccttaatggttttctttggcaatgtggattcatctgggatt
aagcacaatagttttaatcctccaattattgctcgatatatccgtttgcaccccactcat
tctagcatccgtagtactcttcgcatggagttgatgggctgtgatttaaacagttgcagc
ataccattgggaatggaaagtaaagtaatatcagatacacaaatcactgcctcatcctac
ttcaccaatatgtttgctacttggtctccttcacaagctcgacttcacctccagggaagg
actaatgcctggcgacctcaggtaaatgatccaaaagaatggttgcaagtggacttacaa
aagacaatgaaagtcactggaataataacccagggagtgaaatctctctttaccagcatg
tttgtgaaagagttccttatctccagcagtcaagatggccatcactggactcaaatttta
tacaatggcaaggtaaaggtttttcaggggaatcgggactcatccacacctatggtgaat
tctctagacccaccattactcactcgctatcttcgaattcacccccagatctgggagcac
caaattgctctgagacttgagattctaggatgtgaggcccagcagcaatactga

DBGET integrated database retrieval system