KEGG   Mus pahari (shrew mouse): 110313902
Entry
110313902         CDS       T05929                                 
Symbol
Cd99l2
Name
(RefSeq) CD99 antigen-like protein 2 isoform X1
  KO
K06520  CD99 antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110313902 (Cd99l2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110313902 (Cd99l2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110313902 (Cd99l2)
CD molecules [BR:mpah04090]
 Proteins
  110313902 (Cd99l2)
SSDB
Motif
Pfam: CD99L2 ACT_7 Podoplanin
Other DBs
NCBI-GeneID: 110313902
NCBI-ProteinID: XP_021044020
Ensembl: MGP_PahariEiJ_G0031673
LinkDB
Position
X:complement(60209548..60278304)
AA seq 238 aa
MVARLTAFLVCLVFSLATLVQRGYGDVDGLNLEDALKETSSVKQRWDHFSTTTRRPVTTR
APANPAERWDHVATTTRRPGTTRAPSNPMELDGFNLEDALDDRNDLDGPKKPSAGEAGGW
SDKDLEDIVEGGGYKPDKNKGGGGGGYGSNDDPGSGISTETGTIAGVASALAMALIGAVS
SYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVTYSKQETQSAEPPPPEPPRI
NT seq 717 nt   +upstreamnt  +downstreamnt
atggtggccaggctcaccgctttcctcgtttgcctcgttttctccttggccaccctggtt
cagagaggatatggagatgtggatggtcttaatctggaggatgcactgaaagaaacttcc
tcagtaaagcagagatgggaccatttcagcaccacgactaggaggccagtaacaaccaga
gccccagcaaatccagcagagagatgggaccatgtcgctactacaactagaaggccagga
acaactagagcaccatcaaatcctatggaactagatgggtttaacttggaagatgccttg
gatgatcgaaatgacctagatggccccaaaaagccaagtgcaggagaagcgggaggttgg
tcagacaaggatcttgaagacatcgtggaaggcgggggatacaaacctgacaagaataaa
ggtggtggtggtggtggttatggcagcaacgatgaccctggatctggcatatcgacagaa
actggcaccattgcaggtgtggccagtgcccttgctatggccttgattggagctgtatcc
agctacatctcctaccagcagaagaagttttgcttcagcattcagcagggtctcaatgca
gactacgtgaagggggagaacctggaagctgttgtgtgtgaggaaccccaagtgacatac
tcaaaacaagaaacacagtctgcagaacccccaccacctgagccaccccggatttga

DBGET integrated database retrieval system