KEGG   Mus pahari (shrew mouse): 110314138
Entry
110314138         CDS       T05929                                 
Symbol
Vsig4
Name
(RefSeq) V-set and immunoglobulin domain-containing protein 4
  KO
K19822  V-set and immunoglobulin domain-containing protein 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110314138 (Vsig4)
SSDB
Motif
Pfam: V-set Ig_3 V-set_CD47 ig I-set
Other DBs
NCBI-GeneID: 110314138
NCBI-ProteinID: XP_021044260
Ensembl: MGP_PahariEiJ_G0031790
LinkDB
Position
X:complement(82773003..82797386)
AA seq 280 aa
MEISSGLLFLGHLIVLTYGHPTLKTPESVTGTWKGDVKIQCIYDPLRGYKQVLVKWLVRR
GSNHVTIFLRDSTGDHIQLAKYRGRLKVSHNVPGDVSLQLNTLQMDDRNDYTCEVTWQTP
DGNQVLGYKIIELRVQKYNPPKINTEAFTTMHSSLEPTTIMSSTTDLTTNRTGKLERTTA
GSGRNLPVFAIIFIISLCCIVAVTIPYILFRCRTFQQEYVYGVSRVFARETSSSEETTRG
TTIATDETDSQALISDYSDDLCLSQEYQITTRSTMSIPAC
NT seq 843 nt   +upstreamnt  +downstreamnt
atggagatctcatcaggcttgctgttcctgggccacctaatagtgctcacctatggccac
cctaccctaaaaacaccagagagtgtgacagggacttggaaaggagatgtgaagattcag
tgcatctatgatcccctgagaggctacaagcaagttttggtgaaatggctggtacgacgc
ggctctaaccatgtcaccatcttcctacgtgactccactggagaccatatccagctggca
aaatacagaggccgcctgaaagtgagccataacgttccaggagatgtgtccctccaactg
aataccctacagatggatgacaggaatgactacacatgtgaggtcacctggcagactcct
gatggaaaccaagtattaggatataagatcattgagctccgtgtccagaaatataatcca
cctaaaatcaatactgaagcatttacaaccatgcactcctctttggaaccaacaactata
atgagttcaaccactgacttgaccactaataggactggaaagcttgagaggaccactgct
ggttcaggaaggaacctgccagtctttgccataatcttcatcatctccctttgctgcatt
gtagctgtcaccataccttatatcttgttccgctgcaggactttccaacaagagtatgtc
tatggagtgagcagggtgtttgccagggagacaagcagctctgaagaaaccacaaggggg
actaccatcgcaactgatgaaacagattcccaggctctgatcagtgactactctgatgat
ctttgcctcagccaggagtaccaaataaccaccagatcaacaatgtctattcctgcctgc
tga

DBGET integrated database retrieval system