KEGG   Mus pahari (shrew mouse): 110315110
Entry
110315110         CDS       T05929                                 

Symbol
Nos3
Name
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00220  Arginine biosynthesis
mpah00330  Arginine and proline metabolism
mpah01100  Metabolic pathways
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04611  Platelet activation
mpah04915  Estrogen signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04931  Insulin resistance
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110315110 (Nos3)
   00330 Arginine and proline metabolism
    110315110 (Nos3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110315110 (Nos3)
   04371 Apelin signaling pathway
    110315110 (Nos3)
   04066 HIF-1 signaling pathway
    110315110 (Nos3)
   04020 Calcium signaling pathway
    110315110 (Nos3)
   04071 Sphingolipid signaling pathway
    110315110 (Nos3)
   04022 cGMP-PKG signaling pathway
    110315110 (Nos3)
   04151 PI3K-Akt signaling pathway
    110315110 (Nos3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110315110 (Nos3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110315110 (Nos3)
   04921 Oxytocin signaling pathway
    110315110 (Nos3)
   04926 Relaxin signaling pathway
    110315110 (Nos3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110315110 (Nos3)
   05418 Fluid shear stress and atherosclerosis
    110315110 (Nos3)
   05415 Diabetic cardiomyopathy
    110315110 (Nos3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110315110 (Nos3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110315110 (Nos3)
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     110315110 (Nos3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 110315110
NCBI-ProteinID: XP_021044913
Ensembl: MGP_PahariEiJ_G0021779
LinkDB
Position
2
AA seq 1202 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSQAPAPPSPTRPAPAHSPPLTR
PPDGPRFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQSRPTQGPSPTE
QLLGQARDFINQYYNSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCRTAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDF
RIWNSQLIRYAGYRQQDGSVRGDPANVEITELCIQHGWSPGNGRFDVLPLLLQAPDEPPE
LFTLPPEMVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSSE
IGMRDLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHH
AATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWK
GSAAKGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSP
RPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAAQ
DIFSPKRSWKRQRYRLSTQAESLQLLPGLTHVHRRKMFQATILSVENLQSSKSTRATILV
RLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPPSAEPVAVEQLEKGSPGGPP
PGWVRDPRLPPCTLRQALTYFLDITSPPSPRLLRLLSTLAEESSEQQELEALSQDPRRYE
EWKWFSCPTLLEVLEQFPSVALPAPLILTQLPLLQPRYYSVSSAPSAHPGEIHLTIAVLA
YRTQDGLGPLHYGVCSTWMSQLKAGDPVPCFIRGAPSFRLPPDPNLPCILVGPGTGIAPF
RGFWQDRLHDIEIKGLQPAPMTLVFGCRCSQLDHLYRDEVLDAQQRGVFGQVLTAFSRDP
GSPKTYVQDLLRTELAAEVHRVLCLEQGHMFVCGDVTMATSVLQTVQRILATEGGMELDE
AGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWSFDPPGPETP
GS
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcctgggccaccctgtggcctagggctcggg
ctgggcttagggctgtgcggcaagcagggcccagcctctccggcaccggagcctagccag
gcaccagcacccccgtccccaacccgaccagcaccagcccacagccccccgctaacccgg
cccccagacggacccaggtttcctcgcgtgaagaactgggaagtgggcagcatcacctac
gacaccctcagtgcccaggctcagcaggatgggccctgtaccccaagacgctgcttggga
tccctggtgtttccaagaaagttacagagccggcccacccagggcccctcacccactgag
cagctattgggtcaagcccgggacttcatcaatcagtactataactccatcaaaaggagt
ggctcccaggctcatgaacagcggcttcaggaagtggaagctgaggtggcagccacaggc
acctaccagctccgggagagcgagctggtgtttggggccaagcaggcctggcgcaatgct
ccccgctgcgtgggccggatccagtggggaaagctgcaggtatttgatgctcgggactgc
aggactgcacaggaaatgttcacctacatctgtaaccacattaagtatgcaacaaataga
ggcaatcttcgctcagccatcacagtgttcccacagcgctgccctggccggggagacttc
aggatctggaacagccagctgatacgttatgcgggctataggcagcaggatggctccgtg
cgaggggaccctgccaacgtggagatcactgagctctgtatccaacatggctggagccca
ggaaatggccgctttgatgtgctgcccctgttactccaggctcctgatgagcccccagaa
ctcttcactctgcccccagagatggtcctcgaggtgcctctggagcaccccacgcttgag
tggttcgccgcccttggcctgcgctggtatgccctcccagctgtgtccaacatgctgcta
gaaatcgggggcctggagtttcctgctgcccctttcagcggctggtacatgagttcggag
attggcatgagggacctgtgtgaccctcaccgctacaacatactcgaggatgtggctgtc
tgcatggatctagacaccaggacaacctcgtccctgtggaaagacaaggcagcggtggaa
attaatgtggctgtactgcacagttaccagctggccaaagtgaccatagtggaccaccac
gccgccacagcctccttcatgaagcacctggaaaatgagcagaaggccagaggaggctgc
cctgccgactgggcctggattgtgccccccatctcaggcagcctaactcctgttttccat
caagagatggtcaactacttcctgtcccctgccttccgctaccagccagacccctggaag
ggaagtgcagcaaagggggcaggcatcaccaggaagaagacctttaaggaagtagccaat
gcagtgaagatctctgcctcactcatgggcacggtgatggcgaagcgtgtgaaggcgacc
attctgtatggctctgagactggccgggcccagagctacgcacagcagctgggaaggctc
ttccggaaggcgtttgatccccgggtcctgtgcatggatgagtatgatgtggtatcccta
gagcatgaggcactggtgttggtggtgaccagcacatttggcaatggggatcccccggag
aatggagagagctttgcagcagcactcatggaaatgtcaggcccgtacaacagctcccct
aggcctgagcagcacaagagctacaaaatccgattcaacagcgtctcctgctcagaccca
ctggtatcctcttggcggcgcaagaggaaggagtctagcaacacagacagtgcaggagcc
ctgggcaccctcaggttctgtgtgtttgggttgggctcccgagcatacccgcacttctgt
gccttcgctcgagcggtggacacaaggctggaggagctgggaggggagcgactactgcag
ctgggccaaggtgatgagctctgtggccaggaggaggctttccgaggctgggcccaggcc
gctttccaggctgcctgtgaaaccttctgtgtgggagaagatgccaaagctgctgcccaa
gatatcttcagccccaaacgcagctggaagcgccagaggtaccggctgagtacccaggct
gagagcctgcagttactaccaggactgactcatgtgcacaggcgaaagatgttccaggct
acaatcctctctgtggaaaacctacagagcagcaaatccacccgagccacaatcctggtg
cgtctagacaccggtggccaggagggactgcagtaccagccaggggaccacataggtgtg
tgcccacccaaccgtcctggcctagtggaggcgctgctgagccgagtggaggaccctccg
ccatccgcagaacctgtggccgtggagcagctggagaaaggcagccctggtggccctccc
cccggctgggtacgggacccccggctacccccatgtacgctgcggcaggctctcacctac
ttcctggacatcacctccccacccagtcctcgcctccttcgactgctcagcaccctggca
gaggagtccagcgaacagcaggagctagaggctctcagccaggacccccggcgctacgaa
gagtggaagtggttcagctgccccacactgctagaggtgctggaacaatttccttcagtg
gcactgcctgccccgctgatcctcacccagctgcccctgctccagccccggtactactct
gtcagttcagcacccagcgcccacccgggagagatccacctcaccatagctgtgctggca
tacagaacccaggatgggctgggccctctgcactacggcgtctgctccacatggatgagc
cagctcaaggcgggagacccagtgccctgcttcatcaggggggctccctccttccggctg
ccacctgatcctaacttgccctgcatcctggtgggcccggggactggcattgcacccttc
aggggattctggcaagacagactacatgacattgagatcaaagggctacaacctgccccc
atgactttggtgtttggctgccgatgctcccagctggaccatctttaccgggacgaggta
ttggacgcccagcagcgtggggtgtttggacaagtcctcaccgccttttccagggatcct
ggcagccccaagacctacgtgcaagacctcctgaggacagagctggccgcggaggttcac
cgtgtgctgtgcctcgagcaaggacatatgtttgtctgcggcgatgtcactatggcaacc
agcgtcctgcaaaccgtgcagcgaattctagcaacagagggcggcatggagctggatgaa
gccggtgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaggacattttcgga
ctcacgttgcgcacccaggaggtgacaagccgcatacgcacccagagcttttctttgcag
gagcgacagctgaggggcgcagtgccctggtcctttgacccacctggcccagaaacgcct
ggttcctga

DBGET integrated database retrieval system