Mus pahari (shrew mouse): 110315179 Help Entry 110315179         CDS       T05929                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04151   PI3K-Akt signaling pathway mpah04217   Necroptosis mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04622   RIG-I-like receptor signaling pathway mpah04623   Cytosolic DNA-sensing pathway mpah04630   JAK-STAT signaling pathway mpah04650   Natural killer cell mediated cytotoxicity mpah04936   Alcoholic liver disease mpah05152   Tuberculosis mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05162   Measles mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05165   Human papillomavirus infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05168   Herpes simplex virus 1 infection mpah05169   Epstein-Barr virus infection mpah05170   Human immunodeficiency virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05320   Autoimmune thyroid disease mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110315179    04151 PI3K-Akt signaling pathway     110315179   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110315179  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110315179  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110315179    04621 NOD-like receptor signaling pathway     110315179    04622 RIG-I-like receptor signaling pathway     110315179    04623 Cytosolic DNA-sensing pathway     110315179    04650 Natural killer cell mediated cytotoxicity     110315179  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110315179   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110315179    05161 Hepatitis B     110315179    05160 Hepatitis C     110315179    05171 Coronavirus disease - COVID-19     110315179    05164 Influenza A     110315179    05162 Measles     110315179    05168 Herpes simplex virus 1 infection     110315179    05163 Human cytomegalovirus infection     110315179    05167 Kaposi sarcoma-associated herpesvirus infection     110315179    05169 Epstein-Barr virus infection     110315179    05165 Human papillomavirus infection     110315179   09171 Infectious disease: bacterial    05152 Tuberculosis     110315179   09163 Immune disease    05320 Autoimmune thyroid disease     110315179   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110315179   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110315179  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110315179 Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interferons    110315179 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon STX6_10_61_N Motif Other DBs NCBI-GeneID:  110315179 NCBI-ProteinID:  XP_021044962 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MARLCAFLVILIVMSYWSACSLGCHLPHTSNLRNKRALTLLEQLRRLPPLSCLKDRKDFG FHLENVDAQQVQKAQAILVLRDLTQQILNLFTRKDSSATWNATLLDSFCNDLHQQLNDLK ACVMQEVVVQEPPLIQEDSLAVRIYFHRISVYLRKKKHSPCAWEVVRAEVWRALSSSAKL LARLSKEEE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggctaggctctgtgctttccttgtgatcctgatagtgatgagctactggtcagcgtgt tctctaggatgtcacctgcctcacacttctaacctcaggaacaagagggccttgacactc ctggaacaactgagaagactcccccctctttcctgcctgaaggacaggaaggactttgga ttccatttggagaatgtggatgcccaacaggtccagaaggctcaagccatccttgtgctg agagaccttacccagcagatcttgaacctcttcacaagaaaggactcatctgctacttgg aatgcaactctcctagactccttctgcaatgacctccaccagcagctcaacgacctcaaa gcctgtgtgatgcaggaggttgtggtgcaggaacctcccctgatccaggaagactccctg gctgtgagaatatacttccacaggatctctgtgtacctgagaaagaagaaacacagcccc tgtgcctgggaagtggtcagagcagaagtctggagagccctgtcttcctcagccaagctg ctggcaagactgagtaaggaggaggagtga

DBGET integrated database retrieval system