KEGG   Mus pahari (shrew mouse): 110315756
Entry
110315756         CDS       T05929                                 
Name
(RefSeq) complement factor H-related protein 4-like
  KO
K23815  complement factor H-related protein 1/2/3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110315756
SSDB
Motif
Pfam: Sushi Sushi_2
Other DBs
NCBI-GeneID: 110315756
NCBI-ProteinID: XP_021045393
LinkDB
Position
Unknown
AA seq 245 aa
TCSVSDIEIENGFFSESDGTYDLNRVTSYRCKQGYVTNTGETSGSITCLQNGWSLQPSCI
KSCERPVFENSVTKNNSTWFKLNDKLDYECLLGYENEYKHTKGSITCTYHGWSDIPSCYD
STKACGPPPPIDNGDITSLSLPVYAPLSSVDYQCQKYYLLKGKKTATCRNGKWSEPPTCL
HACVIREDIMERFNIILRWREDKKVYIQSGEDIEFACKPRYREARGSPPFHTKCINGHIH
YPTCV
NT seq 740 nt   +upstreamnt  +downstreamnt
agacatgttcagtatcagatatagaaattgagaatggttttttttctgaatctgatggta
catatgatctaaatagagtaacatcgtatagatgtaaacaaggatatgtgacaaatactg
gagaaacatcaggatcaattacttgccttcaaaatggatggtcacttcaaccctcatgca
ttaagtcttgtgaaaggcctgtatttgagaattctgtaactaagaataatagcacatggt
ttaaactcaatgacaaattagactatgaatgtctccttggatatgaaaatgaatataaac
acaccaaaggctctataacatgtacttaccatggatggtctgatattccctcatgttatg
actcaacaaaggcatgtgggcctcctcctcctattgacaatggagacatcacctccttat
cattaccagtatatgcaccattatcatcagttgactatcagtgccagaagtattatctcc
ttaagggaaagaagacagcaacatgtagaaatggaaagtggtctgagccaccaacctgtt
tacatgcatgtgtaatacgagaagatattatggaaagatttaacataattctcagatgga
gagaagacaaaaaggtttatattcagtcaggggaggatattgagtttgcatgtaaaccta
gatatagagaagcaagaggatcaccaccatttcatacaaagtgcattaatggtcacatcc
attatcccacttgtgtataa

DBGET integrated database retrieval system