Mus pahari (shrew mouse): 110315911 Help Entry 110315911         CDS       T05929                                  Symbol Cav2 Name (RefSeq) caveolin-2   KO K12958   caveolin 2 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04144   Endocytosis mpah04510   Focal adhesion mpah05020   Prion disease mpah05100   Bacterial invasion of epithelial cells mpah05205   Proteoglycans in cancer mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110315911 (Cav2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     110315911 (Cav2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     110315911 (Cav2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110315911 (Cav2)   09164 Neurodegenerative disease    05020 Prion disease     110315911 (Cav2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110315911 (Cav2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110315911 (Cav2) Membrane trafficking [BR:mpah04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     110315911 (Cav2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  110315911 NCBI-ProteinID:  XP_021045523 Ensembl:  MGP_PahariEiJ_G0021872 LinkDB All DBs Position 2:37866503..37874011 Genome browser AA seq 162 aa AA seqDB search MGLETEKADVQLFMADDAYSHHSGVDYADPEKYVDSSQDRDPHQLNSHLKLGFEDLIAEP ETTHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSVTDVVIGPLCTSVGRTFSSVSMQLSHD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggctggagactgagaaggccgatgtgcagctcttcatggctgatgacgcctacagc caccacagtggcgtcgactacgcagatcctgagaagtacgttgactcgagtcaggaccgg gatcctcaccagctcaactctcatctcaagctaggcttcgaggatctgattgcagagcct gagactacacactcctttgacaaagtgtggatctgtagccatgccctctttgaaatcagc aaatatgtgatctacaagttcctgaccgtgtttctggccatccccttggccttcatcgcg ggtatcctgtttgctaccctcagctgtctgcacatctggatcctaatgccttttgtgaag acctgcctaatggtcttgccttccgtgcagacaatatggaagagtgtgaccgatgttgtc attggcccattgtgtacaagtgtgggacgcaccttctcatcggtcagcatgcaactgagt cacgactga

DBGET integrated database retrieval system