KEGG   Mus pahari (shrew mouse): 110315912
Entry
110315912         CDS       T05929                                 

Gene name
Arrb1
Definition
(RefSeq) beta-arrestin-1 isoform X1
  KO
K04439  beta-arrestin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04062  Chemokine signaling pathway
mpah04144  Endocytosis
mpah04340  Hedgehog signaling pathway
mpah04728  Dopaminergic synapse
mpah04740  Olfactory transduction
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah05032  Morphine addiction
mpah05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110315912 (Arrb1)
   04340 Hedgehog signaling pathway
    110315912 (Arrb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110315912 (Arrb1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110315912 (Arrb1)
  09152 Endocrine system
   04929 GnRH secretion
    110315912 (Arrb1)
   04926 Relaxin signaling pathway
    110315912 (Arrb1)
   04928 Parathyroid hormone synthesis, secretion and action
    110315912 (Arrb1)
  09156 Nervous system
   04728 Dopaminergic synapse
    110315912 (Arrb1)
  09157 Sensory system
   04740 Olfactory transduction
    110315912 (Arrb1)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    110315912 (Arrb1)
  09165 Substance dependence
   05032 Morphine addiction
    110315912 (Arrb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110315912 (Arrb1)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    110315912 (Arrb1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C
Other DBs
NCBI-GeneID: 110315912
NCBI-ProteinID: XP_021045528
Ensembl: MGP_PahariEiJ_G0013251
LinkDB
Position
1
AA seq 418 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHACPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDNVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggcgacaaagggacacgagtgttcaagaaggcaagccccaatggaaagctcactgtc
tacctgggaaagcgggactttgtggaccacattgacctcgtggaccccgtggatggcgtg
gtcctggtggatcctgagtatctcaaagaaaggcgagtctacgtgacactgacctgcgcc
ttccggtacggccgggaagatctggacgtcttgggtctgacttttcgcaaagacctgttt
gtggccaatgtgcagtccttcccaccggcccccgaggacaagaagccgctaacgcggctc
caggagcgactcatcaagaagctgggcgagcatgcctgccccttcacctttgagatcccg
ccaaaccttccgtgctcagtcacattgcagcctgggcccgaggacacaggaaaggcctgt
ggtgtggactatgaagtcaaagccttctgcgccgagaacctggaggagaagatccacaaa
aggaattctgtgcggctagtcatccggaaggttcagtatgcccctgagaggcctggccct
cagcccacggctgagaccaccagacagttccttatgtcagacaagcccctacaccttgag
gcgtctctggataaggagatctattaccatggagaacccatcagtgttaatgtccacgtc
accaacaacaccaacaagactgtgaagaagatcaagatctcggtgcgccagtatgcagac
atctgtctcttcaacacagctcagtacaagtgcccagtagccatggaggaggctgatgac
aacgtggcacccagctcaacattctgcaaggtctacacactgactcccttcctggccaac
aaccgagagaagcggggacttgcccttgatgggaagctcaagcacgaggacacgaatctg
gcttccagcacgctgttgcgggaaggtgccaaccgtgaaatcctgggcatcatcgtttcc
tacaaagtcaaggtgaagctggtggtgtcccggggcggcctcttgggagaccttgcatcc
agtgatgtggccgtggaactgccttttaccctaatgcaccccaagcctaaggaggagccc
ccacatcgggaagttccagagagcgagactccagtagacaccaatctcatagagcttgac
accaatgatgacgacattgtatttgaggactttgctcgccagcggctgaaaggcatgaag
gatgacaaggacgaagaggatgacggcacgggctctccgcacctcaacaacagatag

KEGG   Mus pahari (shrew mouse): 110332625
Entry
110332625         CDS       T05929                                 

Gene name
Arrb2
Definition
(RefSeq) beta-arrestin-2 isoform X1
  KO
K04439  beta-arrestin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04062  Chemokine signaling pathway
mpah04144  Endocytosis
mpah04340  Hedgehog signaling pathway
mpah04728  Dopaminergic synapse
mpah04740  Olfactory transduction
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah05032  Morphine addiction
mpah05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110332625 (Arrb2)
   04340 Hedgehog signaling pathway
    110332625 (Arrb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110332625 (Arrb2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110332625 (Arrb2)
  09152 Endocrine system
   04929 GnRH secretion
    110332625 (Arrb2)
   04926 Relaxin signaling pathway
    110332625 (Arrb2)
   04928 Parathyroid hormone synthesis, secretion and action
    110332625 (Arrb2)
  09156 Nervous system
   04728 Dopaminergic synapse
    110332625 (Arrb2)
  09157 Sensory system
   04740 Olfactory transduction
    110332625 (Arrb2)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    110332625 (Arrb2)
  09165 Substance dependence
   05032 Morphine addiction
    110332625 (Arrb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110332625 (Arrb2)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    110332625 (Arrb2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 110332625
NCBI-ProteinID: XP_021069567
Ensembl: MGP_PahariEiJ_G0017761
LinkDB
Position
14
AA seq 429 aa
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTV
RMLFVSRRAWGLGMFGIGIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHK
RNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVH
VTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLS
DNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVEL
PFVLMHPKPHDHITLPRPQSAPRETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMK
DDDCDDQFC
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgggagaaaaacccgggaccagggtcttcaagaagtcgagccctaactgcaagctcacc
gtgtacttgggcaagcgcgactttgtagatcacctggacaaagtggaccctgtggatggc
gtggtgctcgtggaccctgactacttgaaggaccgaaaagtgttcgtgaccctcacctgt
gccttccgctatggccgagaagacctggacgtactgggcctgtctttccgcaaagatctg
ttcatcgccacctatcaggccttcccccccatgcccaacccacctcggcccccaacccgc
ctacaggaccggctgctgaagaagttgggccaacacgcccacccattctttttcacagtg
aggatgctcttcgtgtcccgcagggcatggggtctggggatgtttgggattgggataccc
cagaatttgccttgttccgtcacactgcagccaggaccagaggacacagggaaggcctgt
ggagtagactttgagattcgagctttctgtgccaaatcaatagaagaaaaaagccacaaa
aggaactctgtgcggcttatcatcagaaaggtacagtttgctcctgagacacccggtccc
cagccctccgctgaaaccacacgccacttcctcatgtctgaccggaggtccctccaccta
gaggcttccctggacaaagagctgtactaccacggggagccccttaatgtcaatgtccac
gtcaccaacaattctgccaagaccgtcaagaagatcagagtgtctgtgagacagtatgcc
gacatctgcctcttcagcaccgcgcagtacaagtgtcctgtggctcagctagaacaagat
gaccaggtgtctcccagttccacgttctgcaaggtgtacaccatcaccccgctgctcagt
gacaaccgagagaagcgtggccttgccctggatgggcagctcaagcatgaagacaccaac
ctggcttccagcaccattgtgaaggagggagccaacaaggaggtgctggggattctggta
tcctacagggtcaaggtgaagctggtggtgtctcgaggcggagatgtctccgtggagcta
cctttcgtcctaatgcaccccaagccccatgaccacatcacccttcccagaccccagtca
gccccccgggaaacagacgttcctgtggataccaacctcatcgaattcgataccaactat
gccacagacgatgacatcgtgtttgaggactttgcccggctccggctgaaggggatgaag
gatgatgactgtgatgaccaattctgctag

DBGET integrated database retrieval system