KEGG   Mus pahari (shrew mouse): 110316104
Entry
110316104         CDS       T05929                                 

Gene name
Met
Definition
(RefSeq) hepatocyte growth factor receptor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04360  Axon guidance
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah05100  Bacterial invasion of epithelial cells
mpah05144  Malaria
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05211  Renal cell carcinoma
mpah05218  Melanoma
mpah05223  Non-small cell lung cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110316104 (Met)
   04014 Ras signaling pathway
    110316104 (Met)
   04015 Rap1 signaling pathway
    110316104 (Met)
   04020 Calcium signaling pathway
    110316104 (Met)
   04151 PI3K-Akt signaling pathway
    110316104 (Met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110316104 (Met)
   04520 Adherens junction
    110316104 (Met)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110316104 (Met)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316104 (Met)
   05202 Transcriptional misregulation in cancer
    110316104 (Met)
   05206 MicroRNAs in cancer
    110316104 (Met)
   05205 Proteoglycans in cancer
    110316104 (Met)
   05208 Chemical carcinogenesis - reactive oxygen species
    110316104 (Met)
   05230 Central carbon metabolism in cancer
    110316104 (Met)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110316104 (Met)
   05226 Gastric cancer
    110316104 (Met)
   05218 Melanoma
    110316104 (Met)
   05211 Renal cell carcinoma
    110316104 (Met)
   05223 Non-small cell lung cancer
    110316104 (Met)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110316104 (Met)
  09174 Infectious disease: parasitic
   05144 Malaria
    110316104 (Met)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110316104 (Met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110316104 (Met)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110316104 (Met)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  MET family
   110316104 (Met)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 110316104
NCBI-ProteinID: XP_021045848
Ensembl: MGP_PahariEiJ_G0021874
LinkDB
Position
2
AA seq 1379 aa
MKAPTVLAPGILVLLLTLVKRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGS
HIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDCFPCQDCSNKANSSGGVWKDNINVAL
LVDTYYDDQLISCGSVDRGTCRRHVLPPDNPADIHSEVHCMFSPEEESGQCPDCVVSALG
AKVLLSEKDRFINFFVGNTINSSYPPGYSLHSISVRRLKETQDGFKFLTDQSYIDVLPEF
RDSYPIKYIHAFESNHFIYFLTVQKETLGAQTFHTRIIRFCSVDSGLHSYMEMPLECILT
EKRRRRSTREEVFNILQAAYVSKPGASLAKQIGASPSDDILYGVFAQSKPDSAEPMNRSA
VCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARSEEYRTEFT
TALQRVDLFMGRLNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVLSRTAHFTPHVNFLL
DSHPVSPEVIVEHPSDQNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCGWC
HNQCVRSDECPSSTWTQEICLPAVYKVFPTSAPLEGGTVLTICGWDFGFRKNNKFDLRKT
KVLLGNESCTLTLSESTTNTLKCTVGPTMSEHFNVSVIISNSRETTQYSAFSYVNPVVTS
ISPRYGPQAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTISAEFP
VKLKIDLANRETSSFSYREDPVVYEIHPTKSFISGGSTITGIGKTLNSVSLPKLVIDVHE
VGMNYTVACQHRSNSEIICCTTPSLKQLGLQLPLKTKAFFLLDGILSKHFDLTYVHNPVF
EPFEKPVMISMGNENVVEIKGNNIDPEAVKGEVLKVGNQSCESLHWHSGAVLCTVPSDLL
KLNSELNIEWKQAVSSTVLGKVIVQPDQNFAGLIIGAVSISVVVLLSSGLFLWLRKRKHK
DLGSELVRYDARVHTPHLDRLVSARSVSPTAEMVSHESVDYRATFPEDQFPNSSQNGACR
QVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNE
VIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIEEVSQFLTEGIIMKDFSHPNVLSL
LGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVH
RDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTT
KSDVWSFGVLLWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHP
KAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEGNT
NT seq 4140 nt   +upstreamnt  +downstreamnt
atgaaggctcccaccgtgctggcacctggcattctggtgctgctgttgaccttggtgaag
aggagccatggggagtgcaaggaggccttagtgaagtctgagatgaacgtgaacatgaag
tatcagcttcccaacttcacagcagaaacccccatccagaatgtggttctacacggcagt
catatttatcttggagccacaaactacatttatgttttaaatgacaaagacctgcagaag
gtatccgagttcaagaccgggcccgtgttggaacacccagattgttttccttgtcaggac
tgcagcaacaaagccaattcatcaggaggggtttggaaagacaacatcaacgtggctctg
ctcgttgacacatactatgatgatcaactcatcagctgtggcagtgtcgacagagggacc
tgccggcggcatgtccttcctcctgacaaccctgctgacatacactccgaggttcactgc
atgttctccccagaagaagagtcaggtcagtgtcctgactgtgtagtgagtgcccttgga
gccaaagtcctcctgtctgaaaaggaccggttcatcaatttctttgtggggaatacgatc
aattcttcctatcctcccggttattcgctgcattcaatatcggtgagacggctgaaggaa
acccaagatggttttaagtttttgacagaccagtcctatattgatgtcttaccagaattc
cgagattcctaccccataaagtacatacatgcctttgaaagcaaccattttatttacttc
ctgactgtccaaaaggaaaccctaggtgctcagacttttcatacaagaataatcaggttc
tgttccgtagactcggggttgcactcctacatggaaatgcccctggaatgcattctgaca
gaaaaaagaagaaggagatccacacgggaagaagtgtttaatatcctccaagctgcatac
gtcagcaaaccgggggccagtcttgcaaagcagataggcgctagcccatctgatgacatt
ctctatggggtgtttgcacaaagcaagccagattctgctgagcccatgaatcgatcagca
gtctgtgcgttccccatcaaatatgtcaatgacttcttcaacaagattgtcaacaaaaac
aatgtgagatgtctccagcatttttatggacccaaccatgagcactgtttcaataggacc
ctgctgagaaactcttcgggctgtgaagcgcgcagcgaggagtatcggacagaattcacc
acggctttgcagcgcgttgacttattcatgggccggctcaaccaggtgctcctgacatcc
atctccaccttcatcaaaggtgacctcaccattgctaatctagggacgtcagaaggtcgc
ttcatgcaggtagtgctctctcggacggcacacttcacccctcatgtgaacttcctcctg
gattcccatcctgtgtctccagaagttattgttgagcatccatcagatcaaaatggctat
acattggttgtcacaggaaagaagatcaccaagattccactgaatggcctgggctgtgga
catttccagtcctgcagtcagtgtctctctgccccttactttatacagtgtggctggtgc
cacaatcaatgtgtgcgttctgatgaatgccccagcagtacatggactcaagagatctgt
ctgccagcagtttataaggtgttccccaccagtgcgccccttgaaggaggaacagtgctg
accatctgtggctgggactttggattcaggaagaataataaatttgatttaaggaaaacc
aaagttctgcttggcaacgagagctgtaccttgaccttaagcgagagcacgacaaatacg
ttgaaatgcacagttggtcccacgatgagtgagcacttcaatgtgtctgtaattatctcc
aacagtcgagagacaacacaatacagtgcattttcctacgtaaaccctgtagtaacaagc
atctctccgaggtacggccctcaggctggaggcaccttactcacgttaactgggaaatac
ctcaacagtggcaattctagacacatttcaattggcgggaaaacgtgtactttaaaaagt
gtatcagatagtattctcgaatgctacaccccagcccaaactatctctgctgagtttcct
gtgaaattgaagattgacttggctaaccgagagaccagcagcttcagttaccgggaagac
cccgttgtctatgaaatccacccgaccaaatcttttattagtggtggaagcacaataacg
ggtattgggaagaccctgaactcggtcagcctcccaaagctggtaatagatgtgcatgaa
gtgggtatgaactacacagtggcatgtcagcatcgctcaaactcagagatcatctgctgc
accactccttcactgaaacagctgggcctgcaactccccctgaagaccaaagccttcttc
ctgttagacgggatcctttccaaacactttgatctcacttatgtgcataatcctgtgttt
gagccttttgaaaagccagtaatgatctcaatgggcaatgaaaatgtagtggaaattaag
ggaaacaatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaatcagagc
tgcgagagtctccattggcattccggagctgtgttgtgtacagtccccagtgacctgctc
aaactgaacagcgagctaaatatagagtggaagcaagcagtctcttcaactgtccttgga
aaagtgatcgttcaaccggatcagaattttgcaggattgatcattggtgctgtctcaata
tcagtagtagttttgttatcatccgggctcttcctgtggctgagaaagagaaagcataaa
gatctgggcagtgaattagttcgctatgacgcaagagtacacactcctcatttggatagg
cttgtaagtgcccgaagtgtaagtccaactgcagagatggtttcacatgagtctgtggac
tacagagccacttttccagaagaccagtttcccaactcctctcagaatggagcgtgcaga
caagtgcaatatccgctaacagacctgtcccccatcctgacgagtggagactctgatata
tccagcccgttgctacaaaatactgttcacattgacctcagtgctctaaatccagagctg
gtccaagcagtgcagcatgtagtgattggacccagtagcctgattgtgcatttcaatgaa
gtcataggaagagggcattttggctgtgtctatcatgggactttgttggacaatgacgga
aagaaaattcactgtgctgtgaaatccttgaatagaatcacagatatagaagaggtctcc
cagtttctgactgagggaattatcatgaaagacttcagccatcccaatgttctctcactc
ctgggaatctgcctacggagtgaagggtctcctctggtggtcctgccctacatgaagcat
ggagatcttcgaaatttcattcgaaatgagactcacaatccaactgtgaaagatcttata
ggatttggtcttcaagtagccaaaggcatgaaatatcttgccagcaaaaagtttgtccac
agggacttagctgcaagaaactgcatgttggatgaaaaattcactgtcaaggttgctgat
tttggtcttgccagagacatgtacgataaagagtactatagtgttcacaacaaaacaggt
gcaaagctaccagtgaagtggatggctttagagagtctgcagacgcagaagttcaccacc
aagtcagatgtgtggtcctttggtgtgcttctctgggagctcatgacgcgaggagcccct
ccttaccccgacgtgaacacatttgacatcactatctacctgttacaaggcagaagactc
ttgcagccagaatactgccccgatgccttgtatgaagtgatgctaaaatgctggcacccc
aaagcggaaatgcgcccatccttttctgaactggtctccaggatatcctcaatcttctcc
acgttcattggggagcactatgtccacgtgaacgctacttatgtgaatgtaaaatgtgtt
gctccatatccttctctgttgccatcccaagacaacattgacggcgaggggaacacatga

DBGET integrated database retrieval system