KEGG   Mus pahari (shrew mouse): 110316251
Entry
110316251         CDS       T05929                                 

Gene name
Cul1
Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04114  Oocyte meiosis
mpah04120  Ubiquitin mediated proteolysis
mpah04141  Protein processing in endoplasmic reticulum
mpah04310  Wnt signaling pathway
mpah04340  Hedgehog signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04710  Circadian rhythm
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110316251 (Cul1)
   04120 Ubiquitin mediated proteolysis
    110316251 (Cul1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110316251 (Cul1)
   04340 Hedgehog signaling pathway
    110316251 (Cul1)
   04350 TGF-beta signaling pathway
    110316251 (Cul1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110316251 (Cul1)
   04114 Oocyte meiosis
    110316251 (Cul1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110316251 (Cul1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316251 (Cul1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110316251 (Cul1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110316251 (Cul1)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     110316251 (Cul1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 DUF4980
Other DBs
NCBI-GeneID: 110316251
NCBI-ProteinID: XP_021046050
Ensembl: MGP_PahariEiJ_G0022081
LinkDB
Position
2
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcaaacaggagtcagaatcctcatggactgaagcagattggtcttgaccagatc
tgggatgacctcagagctggaattcagcaagtgtataccagacaaagcatggcaaagtcc
agatacatggaactctacactcatgtttataactactgtactagtgtgcatcagtccaac
caagcccggggtgctggagtccctccttccaagtcaaaaaaggggcagactcctggggga
gctcagtttgttggcttggagttatacaagcgattgaaggagtttttgaagaactatttg
acaaatcttcttaaggatggagaagatttaatggatgagagtgtactgaagttctacact
cagcagtgggaagattaccgattctccagcaaagtgctgaatggaatctgtgcctacctc
aatagacattgggttcgccgtgaatgtgatgaaggacgaaaaggaatatatgaaatctat
tcacttgcattggtgacatggagagattgtttgttcaggccattgaataaacaggtaaca
aatgctgttttaaagttgattgaaaaggaaagaaatggagaaaccatcaatacaagactg
attagtggagttgtacaatcttatgtggaattggggctgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagaaagtactgaattcttacagcagaacccagttactgaatat
atgaaaaaggctgaagctcgtttgcttgaggaacagcggagagttcaggtttacctccat
gagagcacacaagatgaactagcacggaaatgtgagcaggtcctcattgaaaaacacttg
gaaatttttcacacagagtttcagaatttattggatgctgacaagaatgaagatttgggc
cgtatgtataatcttgtatctagaattcaggatggcctaggagaattgaaaaaactacta
gagacacatattcataatcagggtcttgcagcaattgagaagtgtggagaagctgctcta
aatgaccccaagatgtatgtgcagacagtgttggatgttcataaaaaatacaatgccctg
gtgatgtcagcgttcaacaacgatgctggcttcgtcgctgctcttgataaggcttgtggt
cgcttcataaacaacaatgcggttaccaaaatggcccagtcatccagtaaatcccctgag
ctgcttgctcggtactgtgactccttgttgaagaaaagttccaagaacccagaagaggca
gaactagaagacaccctcaatcaagtgatggtggtcttcaagtacatcgaggacaaagat
gtatttcagaagttctatgcaaagatgcttgccaagagactggtacatcaaaacagtgca
agtgacgatgctgaagcaagcatgatctccaagttaaagcaagcttgtggttttgagtac
acttccaaacttcagcgaatgtttcaagacattggtgtaagcaaagatctgaatgaacag
ttcaaaaaacacctgacgaattcagaaccgctggacttggacttcagtattcaggtcctg
agttctggatcgtggccctttcagcagtcttgcacgtttgccttgccgtcagagttggag
cgcagttatcagcgatttacagctttctacgccagccgtcacagtggcagaaaattgaca
tggttgtatcaactgtccaaaggggaactagtcactaactgcttcaaaaacagatacact
ttgcaggcgtccacatttcagatggcaatcctgcttcagtacaacacagaagacgcctac
actgtgcagcagctgactgacagcacgcagattaaaatggacattttggcacaagtccta
cagattttactgaagtcgaaattgctggtcttagaagatgaaaatgccaatgttgatgag
gtggaattgaagccagacaccttaataaagttatatcttggttataaaaataagaaattg
agggttaatatcaatgtaccaatgaaaactgaacagaagcaggaacaagaaaccacacac
aaaaatatagaggaagaccgcaaactactgattcaggcggccatcgtaagaatcatgaaa
atgaggaaggtcctgaaacaccagcaattacttggtgaagtcctcactcagctgtcctcc
aggttcaaacctcgggtcccagtgatcaagaaatgcattgatattctcatcgaaaaagaa
tatttggagcgagtcgatggtgagaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system