KEGG   Mus pahari (shrew mouse): 110316392
Entry
110316392         CDS       T05929                                 

Gene name
Shh
Definition
(RefSeq) sonic hedgehog protein isoform X1
  KO
K11988  sonic hedgehog
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
mpah04360  Axon guidance
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110316392 (Shh)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110316392 (Shh)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316392 (Shh)
   05205 Proteoglycans in cancer
    110316392 (Shh)
  09162 Cancer: specific types
   05226 Gastric cancer
    110316392 (Shh)
   05217 Basal cell carcinoma
    110316392 (Shh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110316392 (Shh)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110316392 (Shh)
Peptidases and inhibitors [BR:mpah01002]
 Cysteine peptidases
  Family C46: hedgehog family
   110316392 (Shh)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110316392 (Shh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 110316392
NCBI-ProteinID: XP_021046321
Ensembl: MGP_PahariEiJ_G0021813
LinkDB
Position
2
AA seq 437 aa
MLLLLTRCFLVILASSLLVCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGAS
GRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG
VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKA
HIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFL
TFLDRDEGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSGPTPGPSALFASRVRPGQR
VYVVAERGGDRRLLPAAVHSVTLREEEAGAYAPLTAHGTILINRVLASCYAVIEEHSWAH
RAFAPFRLAHALLAALAPARTDGGGGSSIPAAQSAAETRGMEPTAGIHWYSQLLYHIGTW
LLDSETLHPLGMAVKSS
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgctgctgctaaccagatgttttctggtgatccttgcttcctcgctgctggtgtgc
cccgggctggcctgcgggcccggcagggggtttggaaagaggcggcaccccaaaaagctg
acccctttagcctacaagcagtttattcccaacgtagccgagaagaccctaggggccagc
ggcagatatgaagggaagatcacaagaaactccgaacgatttaaggaactcacccccaat
tacaacccggacatcatatttaaggatgaggaaaacacgggagcagaccggctgatgact
cagaggtgcaaagacaagctaaatgccttggccatctctgtgatgaaccagtggcctgga
gtgaagctgcgagtgaccgagggctgggatgaagacggccatcattcagaggagtctcta
cactatgagggtcgagcagtggacatcaccacgtccgaccgggaccgcagcaagtacggc
atgctggctcgcctggctgtggaagcaggtttcgactgggtctactatgaatccaaagct
cacatccactgctctgtgaaagcagagaactccgtggcggccaaatccggcggctgcttc
ccgggatccgccacagtgcacctggagcagggcggcaccaagctggtgaaggacttacgt
cccggggaccgcgtgctggcggctgacgaccagggccggctgctgtacagcgacttcctc
accttcctggaccgcgacgaaggcgccaagaaggtcttctacgtgatcgagacgcgggag
ccgcgcgagcgtctgctgctcaccgccgcgcacctgctcttcgtggcgccgcacaacgac
tcagggcccacgcccgggccaagcgcgctctttgccagccgcgtgcgccccgggcagcgc
gtgtacgtggtggctgaacgcggcggggaccgccggctgctgccagccgcggtgcacagc
gtgacgctgcgagaggaggaggcgggcgcgtacgcgccactcacagcgcacggcaccatt
ctcatcaaccgggtgctcgcctcgtgctatgctgtcatcgaggagcacagctgggcacac
cgggccttcgcgcctttccgcctggcgcacgcgctgctggccgcgctggcaccggcccgc
acggacggcgggggcgggagcagcatccctgcagcgcaatctgcagcggaaacgaggggc
atggagccgactgcgggcatccactggtactcgcagctgctctaccacattggcacctgg
ctgctggacagcgagaccctgcatcccttgggaatggcggtcaagtccagctga

DBGET integrated database retrieval system