KEGG   Mus pahari (shrew mouse): 110316414
Entry
110316414         CDS       T05929                                 

Gene name
Smo
Definition
(RefSeq) smoothened homolog
  KO
K06226  smoothened
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
mpah04360  Axon guidance
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110316414 (Smo)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110316414 (Smo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316414 (Smo)
   05205 Proteoglycans in cancer
    110316414 (Smo)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110316414 (Smo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110316414 (Smo)
G protein-coupled receptors [BR:mpah04030]
 Frizzled / Smoothened family
  110316414 (Smo)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 110316414
NCBI-ProteinID: XP_021046369
Ensembl: MGP_PahariEiJ_G0021936
LinkDB
Position
2
AA seq 793 aa
MAAGRPVRGPELAPRRLLQLLLLVLLGGPGRGAALSGNVTGPGPRSASGSARRNAPVTSP
PPPLLSHCGRAAHCEPLRYNVCLGSALPYGATTTLLAGDSDSQEEAHGKLVLWSGLRNAP
RCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPE
GCPNEVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAA
FGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCR
ADGTMRFGEPTSSETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGK
TSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGG
YFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFN
QAEWERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWV
WTKATLLIWRRTWCRLTGHSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSH
DGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEQANLWL
VEAEISPELEKRLGRKKKRRKRKKEVCPLGPAPELHHSAPVPATSAVPRLPQLPRQKCLV
AANAWGTGESCRQGAWTLVSNPFCPEPSPHQDPFLPGASAPRVWAQGRLQGLGSIHSRTN
LMEAELLDADSDF
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggccgctggccgccccgtgcgtgggcccgagctggcgccccggaggctgctgcagttg
ctgctgctggtcctgctggggggcccgggccggggggcggccttgagcgggaacgtgacc
gggcctgggcctcgcagcgccagcgggagcgcgaggaggaacgcgccggtgaccagccct
ccgccgccgctgctgagccactgcggccgggccgcccactgcgagcctttgcgctacaac
gtgtgcctgggctcggcgctgccctacggagccaccaccacgctgctggctggggactcg
gactcgcaggaggaagcgcacggcaagctcgtgctctggtccggcctccggaatgccccc
cgatgctgggcagtgatccagcccctgctgtgtgctgtctacatgcccaagtgtgagaat
gaccgagtggagttgcccagccgcaccctctgccaggccacccgaggtccctgtgccatt
gtggagcgggagcgagggtggcctgactttctgcgttgcacgccggaccacttccctgaa
ggctgcccaaacgaggtacaaaacatcaagttcaacagctcaggccagtgtgaagcaccc
ttggtgcggacggacaaccccaagagctggtacgaggacgtggagggctgtgggatccag
tgtcagaacccactgttcaccgaggccgagcaccaggacatgcacagctacattgcagcc
ttcggggcggtcaccggcctctgcacgctcttcacattggccacctttgtggctgactgg
cggaactccaatcgctaccccgcggttattctcttctatgtcaatgcgtgtttcttcgtg
ggcagcattggctggctggcccagttcatggatggtgcccgccgagagattgtttgccga
gcagatggcaccatgagatttggggagcccacctccagcgagaccctgtcctgtgtcatc
atctttgtcattgtgtactatgccttgatggctggagtagtctggttcgtggtcctcacc
tatgcctggcacacctccttcaaagccctgggcaccacctaccagcctctctcgggcaag
acatcctatttccacctgctcacgtggtcactcccctttgtcctcactgtggcaatcctc
gctgtggctcaggtagatggagactccgtgagtggcatctgctttgtaggctataagaac
tatcggtaccgtgctggctttgtcctggccccgattggcctggtgctcattgtgggaggc
tacttcctcatccgcggggtcatgactctgttctccatcaagagcaaccaccctgggctt
ctgagtgagaaggcagccagcaagatcaacgagaccatgctccgcctgggcatttttggc
ttcctggccttcggctttgtgctcatcaccttcagctgccacttctatgacttcttcaac
caggccgagtgggagcgtagcttccgggactatgtgctatgccaagccaatgtgaccatc
gggctgcctaccaagaagcccattcctgactgtgagatcaagaatcggcccagcctcctg
gtggagaagatcaatctatttgccatgtttggcactggcattgccatgagcacctgggtc
tggactaaggccaccctgctcatctggaggcgcacctggtgcaggttgactgggcacagt
gatgatgaacccaagagaatcaagaagagcaagatgatcgccaaggccttctctaagcgg
cgtgagctgctgcagaacccaggccaggagctctccttcagcatgcacactgtctcccat
gatggacctgtcgcgggtttggcttttgacctcaatgaaccctcagctgacgtctcctct
gcctgggcccagcatgtcaccaagatggtggctcggagaggagccatattgccccaggat
gtgtctgtcaccccggtggcaactccagtgccaccagaagaacaagccaacctgtggctg
gttgaggcagagatctccccagagttagagaagcgtttgggccggaagaagaagcggagg
aagaggaagaaggaggtgtgccccttggggccagcccctgagcttcaccactctgcccct
gttcctgccaccagtgcagttcctcggctgcctcagctgcctcggcagaagtgcctggta
gctgcaaacgcctggggaacaggggagtcctgccgacagggagcctggactctagtctcc
aaccccttctgcccagagcctagtccccatcaagatccatttctccctggtgcctcagcc
ccccgggtctgggctcagggccgcctccaggggctgggatccattcactcccgcactaac
ctaatggaggctgagctcttggatgcagactcggacttctga

DBGET integrated database retrieval system