KEGG   Mus pahari (shrew mouse): 110317061
Entry
110317061         CDS       T05929                                 
Symbol
C3ar1
Name
(RefSeq) C3a anaphylatoxin chemotactic receptor
  KO
K04009  C3a anaphylatoxin chemotactic receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04610  Complement and coagulation cascades
mpah04936  Alcoholic liver disease
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110317061 (C3ar1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110317061 (C3ar1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110317061 (C3ar1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110317061 (C3ar1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110317061 (C3ar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110317061 (C3ar1)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   Anaphylatoxin
    110317061 (C3ar1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7TM_GPCR_Srx Syndecan DUF6737
Other DBs
NCBI-GeneID: 110317061
NCBI-ProteinID: XP_021047075
Ensembl: MGP_PahariEiJ_G0022584
LinkDB
Position
2:complement(138401328..138408007)
AA seq 477 aa
MESFAADTNSTDLHSRPLFQPQDIASMVILGLTCLLGLLGNGLVLWVAGIKMKTTVNTVW
FLHLTLADFLCCLSLPFSLAHLILQGHWPYGLFLCKLIPSIIILNMFASVFLLTAISLDR
CLIVHKPIWCQNHRNVRTAFAICGCVWVVAFVMCVPVFVYRDLFIMDNRSICRYNFDSSS
SSDYRDYMYTLNLPESNSTDNSTPQLTGHMNDRSDPSSVQARDHLWTATTALQSQPFQTS
PEDSFSLDSANQQPHYGGNPPNVLMATIPSGFPVEDHKSNTLNTDAFLSVHTELSPTASS
GHLYPYDFQGDYVDQFMYDNHVPTPLMAMTITRLVVGFLVPFFIMVTCYSLIVFRMRKTN
FTKSRNKTFRVAMAVVTVFFICWTPYHIVGVLLLITDPESSLGEAVISWDHMSIALASAN
SCFNPFLYALLGKDFRKKARQSIKGILEAAFSEELTHSTSCTQDKASSKRNNMSTDV
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggagtctttcgctgctgacaccaattcaactgacctacactcacggcctctgtttcaa
ccccaagacattgcctctatggtcattctcggtctcacttgtttattgggactgctaggc
aatgggctggtgctgtgggtagctggcataaagatgaagacaaccgtgaacacagtctgg
ttcctccatctcaccctggccgatttcctctgctgcctctccttgcccttctccctggct
cacctgattctccaaggacactggccctatggcttgttcctgtgcaaacttatcccatcc
atcattattctcaacatgtttgccagtgtcttcctgcttactgccattagcctggaccga
tgtctgatagtacataagccaatctggtgccagaatcatcgaaacgtgagaacagccttc
gccatctgtggatgtgtctgggtggtagcctttgtgatgtgtgtgcctgtatttgtatac
cgtgatctgttcattatggacaatcgcagtatatgtagatataattttgattcctccagt
tcatctgattatcgggactacatgtacacactaaatctaccagaaagtaattctactgat
aactccactcctcagctaactggacatatgaatgacaggtcagatccttcctctgtacaa
gcaagggatcacctttggacagctaccactgccctccagtcacaaccattccaaacatct
cctgaagactcattctctctagattcagcaaaccaacaaccccattatggtggaaaccct
cctaatgtgctcatggccaccatacccagtgggtttcctgttgaagatcataagtccaat
acactgaacactgacgcttttctctctgttcacacagaactttcccctactgcttctagt
ggtcatttatacccctatgattttcagggggattatgttgaccaattcatgtatgacaat
catgtgccgacaccactgatggcaatgaccatcacaaggctggtggtgggcttcctggtg
ccgtttttcatcatggtaacttgttacagcctcatcgtcttcagaatgcgaaaaaccaac
ttcaccaagtctcggaacaaaacctttcgggtggccatggctgtggtcactgtctttttt
atctgctggactccataccatattgtcggagtcctgttattgattactgatccagaaagt
tccttgggtgaagctgtgatatcctgggaccacatgtccattgctttagcatctgccaat
agttgcttcaaccctttcctttatgccctcttggggaaagactttaggaagaaagcaaga
cagtccataaagggcattctggaagcagccttcagcgaagagctcacgcactctaccagc
tgtacccaagacaaagcctcttcaaaaagaaacaatatgagtacagatgtgtaa

DBGET integrated database retrieval system