KEGG   Mus pahari (shrew mouse): 110317539
Entry
110317539         CDS       T05929                                 
Symbol
C5
Name
(RefSeq) complement C5
  KO
K03994  complement component 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04610  Complement and coagulation cascades
mpah04613  Neutrophil extracellular trap formation
mpah04936  Alcoholic liver disease
mpah05020  Prion disease
mpah05133  Pertussis
mpah05150  Staphylococcus aureus infection
mpah05168  Herpes simplex virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110317539 (C5)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110317539 (C5)
   04613 Neutrophil extracellular trap formation
    110317539 (C5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110317539 (C5)
   05168 Herpes simplex virus 1 infection
    110317539 (C5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110317539 (C5)
   05150 Staphylococcus aureus infection
    110317539 (C5)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110317539 (C5)
  09164 Neurodegenerative disease
   05020 Prion disease
    110317539 (C5)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110317539 (C5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110317539 (C5)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   110317539 (C5)
SSDB
Motif
Pfam: TED_complement A2M_BRD MG1 A2M MG4 A2M_recep NTR MG2 MG3 ANATO
Other DBs
NCBI-GeneID: 110317539
NCBI-ProteinID: XP_021047681
Ensembl: MGP_PahariEiJ_G0024931
LinkDB
Position
3:complement(22265618..22346160)
AA seq 1656 aa
MPLPAMGLWGILCLLIFLDKTWGQEQTYVISAPKIFRVGSSQNVVIQAHGYTEAFDATLS
LKSYPDKKVTFSSGYTNLSPENKFQNSALLTLQPSQVPREESPVSHVYLEVVSKHFSKAK
KIPITYDNGILFIHTDKPVYTPDQSVKIRVYSLSDDLKPAKRETVLTFIDPEGAEVDIVE
ENDYTGIISFPDFKIPSNPKYGVWTIKANYKKDFTTTGTAYFEIKEYVLPRFSVLIEPES
NFIGYKNFRNFEITVKARYFYNKAVSDAEVYVFFGLREDIKEDEKQMMHKATQAANLIDG
VAQISFNSETAVKELFYNSLEDLNNKYLYIAVTVTETSGGFSEEAEIPGIKYVISPYTLN
LVATPLFVKPGIPFSIKAQVKDSLEQTVGGVPLMLMVQTVNVNQETTDLETKRSITHASD
GVALFVVNVPSNVTALKFEVRTDAPELPEENQVSREYEAVAYSSLSQSYLYIAWTENYKP
MLVGEYLNIMVTPKSPYIDKITHYNYLILSKGKIVQYGTRKKLFSSTYQNINIPVTQNMV
PSARLLVYYIVTGEQTAELVADAVWINIEEKCGNQLQVRLSPDEYMYSPGQTVSLDMVTE
ADSWVALSAVDRAVYNVQGKAKRAMQRVFQTLDDKSDLGCGAGGGHDNADVFHLAGLTFL
TNANADDSHYHDDSCKEILRPKRDLHHLKQKIKEQAAKYKHPVPRKCCYDGARVNFYETC
EERVARVTLGPLCIRAFIECCTTATKIRKESPHKPVQLGRIHIKTLLPVMKADIRSYFPE
SWLWEVHRVPKRNQLQVVLPDSLTTWEIQGIGISDNGICVADTLKTKVFKEIFLEMNIPY
SVVRGEQIQLRGTVYNYMTSGTKFCVKMSAVEGICTSGSSAASHHTSRPSRCVPQRIEGS
SSHLVTFSLLPLEIGLHSINFSLETSFGNEILVKTLRVVPEGVKRESSAGGTLDPKGIRG
IVTRRKEFPYKIPLDLVPKTKVERILSVKGLLIGEFLSTVLSKEGIDILTHLPKGSAEAE
LMSIVPVFYVFHYLEAGNHWNIFYPDTLSKKQSLKKKIKEGMVSVMSYRNADYSYSMWKG
ASASTWLTAFALRVLGQVAKYVKQDENSICNSLLWLVEKCQLENGSFKENSQYLPIKLQK
IYTALDKADSFLLENALPSKSTFTLAIVAYALSLGDTTHQRLRLIVSTLKKEAFVKGDPP
VYRYWRDTLNHPDSSVPNSGTAGMVETTAYALLASLKLKDMNYVNPIIKWLSEEQRYGGG
FYSTQDTINAIEGLTEYSLLMKQLHLDMDINVSYKHKGDLHKYKVTEKHFLGRPVEVPLN
DDIVVTTGHSSGLATVYVKTVVHKTSVSDEFCSFYLKIDTQDVEASSHSRLSDSEYKLII
ACASYKPSKEESTSGSSHAVMDISLPTGMEANHEDLRALVEGVDQLLTNYQIKDGHVILQ
LNSIPSRDFLCVRFRIFELFRVGFQNPATFTVYEYHRPDKKCTMIYSISDTRLQRVCEGA
DCKCVEVDCAQLQAEVDLAISADSRKEKACTPEIAYAYKVRITSATVENIFVKYTASLLA
SYKTGEAAAEDSEVTFIKKMSCTNADLVKGKQYLIMGKEVLQIKHNFSFKYIHPLDSSTW
IEYWPTDTTCPSCQAFVANLNDFAEDLFLNGCENFG
NT seq 4971 nt   +upstreamnt  +downstreamnt
atgccactaccagccatgggtctttggggaatactttgccttttaattttcctggacaaa
acttggggacaggaacaaacctacgtcatttcagcgcccaaaatcttccgggtcggctca
tctcaaaatgtggtaattcaagcccatggctacactgaagcatttgatgcaactctctct
ctaaaaagctatcctgacaaaaaggtgaccttctcttcaggctacactaacttgtccccg
gaaaacaaattccaaaactcggcactgttgacactacagcccagtcaagttcctagagaa
gaaagcccagtctctcacgtgtatctggaagttgtgtcaaaacacttttcaaaagcaaag
aaaataccaattacctatgacaatggaattctcttcatccatacggacaaacctgtctac
actccagaccagtcagtaaagattagagtctattctctgagtgacgacttgaagccagcc
aaacgggagactgtcttaactttcatagaccccgaaggagcagaagttgacatcgtagaa
gaaaatgattataccggaattatctcttttcctgacttcaagattccatctaatcctaag
tatggcgtttggacaattaaagctaactataagaaggattttacaacaactggaactgca
tactttgaaattaaagaatatgtcttgccacgattctctgttttaatagaaccagaaagt
aacttcattggctataaaaactttaggaactttgaaatcactgtgaaagcaagatatttt
tataataaagcggtctctgatgctgaagtgtatgtcttttttggattgagagaggacata
aaagaggatgagaagcagatgatgcacaaagccacgcaagctgcaaatttgattgacgga
gttgctcagatctcttttaattctgaaacagcagttaaagagctgttctacaacagccta
gaagacttaaacaacaagtacctttatattgctgtaacagtcacagaaacttcaggtgga
ttttcagaagaggcagaaatccccggcatcaaatatgtcatctctccctacacactgaat
ttggtcgctacccctctttttgtgaagccggggattccattttccatcaaggcacaggtg
aaggattcgctcgagcagacggtaggaggggtcccattaatgctgatggtacaaacagtc
aatgtgaatcaagagacaactgacttggaaacaaagaggagcatcacgcacgcctctgat
ggagtagctttgtttgtggtgaacgtcccatcaaacgtgacggcgctgaagtttgaggtc
agaaccgatgccccagaacttcccgaagaaaatcaagtcagcagggagtacgaagcagtg
gcctactcgtctctcagtcaaagttacctttacatcgcttggactgaaaactacaagccc
atgcttgtgggagaatacctgaatattatggttacccccaagagcccatatatcgacaaa
ataactcactataattacttgattttatccaaaggcaaaattgtacagtatggcacaaga
aagaaacttttctcttcaacttatcaaaatataaacattccagtgacacagaacatggtt
ccttcagcacgactcctggtctattacatagtcacgggggagcagacagcagaattagtg
gctgacgcagtctggataaatattgaggagaagtgtggcaaccagctccaggtccgtctg
tctccagatgaatatatgtattctccaggccaaactgtgtcccttgacatggtgactgaa
gcagactcgtgggtagcactatccgcagtggacagagctgtgtataacgtccagggaaaa
gccaaaagggccatgcaaagagtctttcaaactttggatgataagagtgacctgggctgt
ggggcaggtggtggccatgacaatgcagatgtattccacctagctgggctcactttcctc
accaacgcaaacgcagatgactcccattaccacgacgactcttgtaaagaaattctcagg
ccaaagagagacctgcatcacctaaagcagaaaataaaagaacaagctgctaagtacaaa
caccccgtgccaaggaaatgctgctatgacggagcccgagtgaacttctacgaaacctgt
gaggagcgagtggcccgggttaccttaggccctctctgcatcagggccttcatcgagtgc
tgtactactgcgaccaagatccgaaaagaaagcccccataagcctgtccagctgggaagg
atccacattaagaccctgttaccagtgatgaaggcagatatccgaagctactttccagag
agctggctatgggaagttcatcgtgttcccaaaagaaaccagctgcaggtcgtgctgcct
gactcactaacgacctgggaaattcaaggcattggcatttcagacaatggtatatgtgtt
gctgatacactcaagacaaaggtgttcaaagaaatcttcctggagatgaacataccgtat
tctgttgtacgaggagaacagatccaattgagaggaactgtttacaactatatgacctca
gggacaaagttctgtgttaaaatgtctgctgtggaggggatctgcacttcaggaagctca
gctgctagccatcacacctccaggccctccagatgtgtgccccagaggatagagggttcg
tccagtcacttggtgaccttcagcctgcttcctctggaaattggccttcactccataaac
ttctcacttgagacctcatttgggaacgaaatcttagtaaagacattacgggtagtgcca
gaaggagtcaagagggaaagctctgccggcgggactctggaccctaagggaattcgtggt
attgttaccagacgaaaggaattcccatacaagataccattagatttggtccccaagacc
aaagttgaaaggattttgagtgtcaaagggctgcttataggggagttcttgtccacggtt
ctgagtaaggaaggcatcgacatactaacccacctccccaagggtagtgctgaggcagag
ctcatgagcatagttccagtgttctatgttttccactacctggaagcaggaaaccattgg
aatattttctatcctgatacattgagtaaaaaacagagcctgaagaaaaaaataaaagaa
gggatggtgagcgtcatgtcctacagaaacgctgactattcctacagcatgtggaaaggg
gcgagcgctagtacctggctgacagcttttgctctgagagtgcttggacaggtggccaag
tatgtaaaacaggatgaaaactcaatttgtaactctttgctatggctggtcgagaagtgt
cagctggaaaacggatctttcaaggaaaattcccaatatctaccaataaaattacagaaa
atctacacagcgctagataaagccgactccttcctgcttgaaaacgccctgccatccaag
agcaccttcacactggccattgtagcctatgctctttccctaggagacacaacccaccag
aggcttcgtctaatcgtgtcaaccctgaagaaggaagcttttgttaaaggtgatccacct
gtttaccgttactggagggatactctcaaccatccagacagctctgtgcccaacagcggc
acagcaggtatggttgaaaccacggcctatgctttgctcgccagcctgaaactgaaggat
atgaattacgtcaacccgatcatcaagtggctatctgaagagcagaggtatggaggcggc
ttttattccacccaggatacaattaatgccatcgagggcctgacagaatattcactcctg
atgaaacaacttcatttggatatggacatcaatgtctcctacaaacacaaaggtgacttg
cacaagtataaggtgacagagaagcatttcctggggaggccagtggaggtacctctcaat
gatgacattgttgtcaccacaggccacagcagtggcctggccacagtatacgtaaaaact
gtggttcacaaaactagtgtctctgatgaattttgcagcttttatttgaaaattgatacc
caagatgttgaagcatccagccactccaggctcagtgactctgaatacaagctcataata
gcatgtgccagctacaagcccagcaaggaggagtcgacatccgggtcctcccatgcggta
atggatatatcactgccgactggaatggaagcaaaccacgaagatttacgtgctcttgtg
gaaggagtggatcaactactaactaattaccagatcaaagatggccatgtcattctgcaa
ctgaattcgatcccctctagagatttcctctgtgtccggttccggatatttgaacttttc
cgagttggctttcagaatcctgctaccttcacggtgtatgagtatcacagaccagataag
aagtgcaccatgatttatagcatttctgataccaggcttcagagagtctgtgaaggagcg
gattgcaaatgcgtggaagttgactgtgcgcaactgcaggcagaagtggacctggccatc
tctgcagactccaggaaagaaaaagcctgtacaccagagattgcatatgcttataaggtc
aggatcacatcagccactgtagaaaacattttcgtcaagtacactgcgagtcttctggct
tcttacaaaacaggggaagctgctgctgaggactctgaggtcaccttcattaaaaagatg
agctgtaccaatgccgacctggtgaaagggaagcagtatttaatcatgggcaaagaggtt
ctgcagatcaaacacaatttcagtttcaagtatatacaccctctagattcctccacctgg
attgaatattggcccacagacacaacgtgtccatcctgtcaagcatttgtagcaaatttg
aatgactttgctgaagacctctttttaaacggctgtgaaaatttcggatga

DBGET integrated database retrieval system