KEGG   Mus pahari (shrew mouse): 110317778
Entry
110317778         CDS       T05929                                 
Symbol
Cdh4
Name
(RefSeq) cadherin-4 isoform X1
  KO
K06797  cadherin 4, type 1, R-cadherin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110317778 (Cdh4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110317778 (Cdh4)
Cell adhesion molecules [BR:mpah04515]
 Cadherins
  Major cadherins
   110317778 (Cdh4)
SSDB
Motif
Pfam: Cadherin Cadherin_pro CADH_Y-type_LIR Cadherin_3 He_PIG Stevor Cytomega_TRL10 RIFIN CD34_antigen
Other DBs
NCBI-GeneID: 110317778
NCBI-ProteinID: XP_021048187
Ensembl: MGP_PahariEiJ_G0026212
LinkDB
Position
3:161721566..162180784
AA seq 913 aa
MTTGSVLPLLLLGLSGALRAHREDLTVREACKAGFSEEGYTALISPNVLEGEKLLKVEFS
SCVGTKGMQYETNSLDFKVGADGTVFATRELKIPSEQVAFTVTARERQSAEQWDAMVRLL
VAQTSSAHSEHKEGQTVALDPSQSPKDTLLLWSRHQSSGGLRRQKRDWVIPPINVPENSR
GPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPMEVFNIDSMSGRMYVTRPMDREERASY
HLRAHAVDMNGNKVENPIDLYIYVIDMNDNRPEFINQVYNGSVDEGSKPGTYVMTVTAND
ADDSTTANGMVRYRIVTQTPQSPSQNMFTINSETGDIVTVAAGLDREKVQQYTVIVQATD
MEGNLNYGLSNTATAIITVTDVNDNPPEFTTSTFAGEVPENRIETVVANLTVMDRDQPHS
PNWNAVYRIISGDPSGHFSVRTDPVTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPLASG
IQMSFQSTAGVTISVTDVNEAPYFPSNHKLIRLEEGVPAGTALTTFSAVDPDRFMQQAVR
YSKLSDPANWLHINTSNGQITTAAVLDRESLYTKNNVYEATFLAADNGIPPASGTGTLQI
YLIDINDNAPQLLPKEAQICERPSLNAINITAADADMDPNIGPYVFELPFIPTTVRKNWT
ITRLNGDYAQLSLRILYLEAGVYDVPIIVTDSGNPPLSNTSVIKVKVCPCDENGDCTTVG
AVAAAGLGTGAIVAILICIVILLIMVLLFVVWMKRREKERHTKQLLIDPEDDVRDNILKY
DEEGGGEEDQDYDLSQLQQPEAMEHVLSKTPGVRRVDERPVGAEPQYPVRPVVPHPGDIG
DFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSSGDQDYDYLNDWGPRF
KKLADMYGGGEED
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgaccacaggctcggtgctgccgctgctgctgctcgggctctcgggcgcgctccgggcc
caccgtgaggatcttacagtcagagaggcctgtaaggctggcttctccgaagaaggctat
actgcgttgatctccccgaatgtcctggaaggagagaaactactcaaagtcgagttcagc
agctgcgtgggcaccaaagggatgcagtatgagaccaacagcttggacttcaaagtcggg
gcagatgggacagtcttcgccactcgggagttgaagatcccctcagagcaggtggccttt
accgtgaccgcacgggaacgccaaagtgctgagcagtgggatgccatggtgcggctgctg
gtagcccagacatcatcagcacactctgaacacaaggaagggcagacagtggccctggac
ccctctcagtccccaaaggacacactgctgctgtggtctcgacatcagagctctggtggg
ctgaggagacagaagcgcgactgggtcatcccacccatcaacgttcccgagaactcccgg
gggcccttccctcagcagcttgtcaggatcaggtcggacaaagacaatgacatccccatc
cgctacagcatcacgggtgtgggcgccgaccagccccccatggaggtcttcaacattgac
tccatgtctggccggatgtatgtcactcggcccatggaccgagaggaaagagcctcttac
catctccgagcccacgcggtggatatgaacggtaacaaggtggagaatcctattgacctg
tacatctatgtcatcgacatgaatgacaaccgtcccgagttcatcaaccaggtctacaat
ggctctgtggatgagggctccaagccaggtacatacgtgatgactgtcacagccaacgat
gcagatgatagcaccacagccaacggcatggtgaggtacaggattgtcacccagacaccc
cagagcccatcccagaacatgttcaccatcaacagtgaaacaggggacatcgtgaccgtg
gcagcaggcctggaccgagagaaagtccagcagtacaccgtcattgtccaggccactgac
atggaaggaaaccttaattacggtctctcgaacacagccactgccatcatcacggtgaca
gacgtaaatgacaaccctccagaattcaccacaagcacatttgcaggagaggttcccgag
aaccgcatagagacagtcgtggccaacctcacggtgatggaccgagaccagccccactca
cccaactggaatgccgtctaccgaatcataagtggggacccctctgggcacttcagtgtc
cgcacagaccccgtgaccaatgagggcatggtcaccgtggtgaaggcagtggactatgag
ctgaaccgagccttcatgctgaccgtaatggtgtccaaccaggcgcccctagccagtggg
atccagatgtccttccagtccacagcgggggtaaccatctctgtcaccgatgtcaatgag
gccccctacttcccctccaaccacaaactgatccgcctggaagagggcgtgcccgctggg
acggcactcaccactttttctgcagtggaccctgaccggttcatgcagcaagccgtgagg
tactcgaaactgtctgatcccgccaactggctgcacatcaacacatccaatgggcagatc
accacagccgcagtcctggaccgagagtccctctacaccaagaacaatgtgtacgaggcc
accttcctggctgctgacaatggaatccccccagccagtggcaccgggaccctgcagatc
tacctcattgatatcaatgacaacgcaccacagctgctacccaaggaggcacagatctgc
gagaggcccagcctcaacgccatcaacatcaccgcagccgacgccgatatggaccccaat
attggcccctacgtctttgagttgcccttcatccccacgacagtgaggaagaattggacc
atcacccgcctaaatggtgactatgcccagctcagtctgcgcatcctgtatctggaagca
ggggtgtatgacgtccccatcatcgtcacggactctggcaaccctcccttgtccaacaca
tctgtcataaaggtcaaggtgtgcccgtgtgatgagaacggcgactgtaccacagtcggc
gcagtggctgcagctggcctgggcacaggcgccatcgtggcgatcctcatctgcatcgtg
atcctgctaatcatggtcctgctgttcgttgtgtggatgaagcggagggaaaaggagaga
cacacaaagcagttgctcatcgaccctgaggacgacgtgagggacaatatcctgaagtac
gatgaagagggcggcggcgaggaggaccaagactatgacctcagccagctacaacagcca
gaagccatggagcatgtgctgagcaaaacccctggtgtgcggcgggtggatgaacggcca
gtgggagctgaaccccagtacccagtcaggcctgtggtgccacacccaggagacattgga
gacttcattaatgagggactccgagctgctgacaacgaccccaccgcacccccctacgac
tccctgctcgtcttcgactatgaaggcagcggttctactgcgggctctgtcagctccctg
aactcctccagctccggggatcaagattacgactacttgaatgactgggggccccggttc
aagaagctggcggacatgtacgggggtggtgaggaggactaa

DBGET integrated database retrieval system