KEGG   Mus pahari (shrew mouse): 110317793
Entry
110317793         CDS       T05929                                 

Symbol
Src
Name
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04012  ErbB signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04137  Mitophagy - animal
mpah04144  Endocytosis
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04530  Tight junction
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04625  C-type lectin receptor signaling pathway
mpah04727  GABAergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah05100  Bacterial invasion of epithelial cells
mpah05135  Yersinia infection
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05219  Bladder cancer
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110317793 (Src)
   04015 Rap1 signaling pathway
    110317793 (Src)
   04370 VEGF signaling pathway
    110317793 (Src)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110317793 (Src)
   04137 Mitophagy - animal
    110317793 (Src)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110317793 (Src)
   04520 Adherens junction
    110317793 (Src)
   04530 Tight junction
    110317793 (Src)
   04540 Gap junction
    110317793 (Src)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110317793 (Src)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110317793 (Src)
   04613 Neutrophil extracellular trap formation
    110317793 (Src)
   04625 C-type lectin receptor signaling pathway
    110317793 (Src)
   04062 Chemokine signaling pathway
    110317793 (Src)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110317793 (Src)
   04915 Estrogen signaling pathway
    110317793 (Src)
   04917 Prolactin signaling pathway
    110317793 (Src)
   04921 Oxytocin signaling pathway
    110317793 (Src)
   04926 Relaxin signaling pathway
    110317793 (Src)
   04919 Thyroid hormone signaling pathway
    110317793 (Src)
  09156 Nervous system
   04727 GABAergic synapse
    110317793 (Src)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110317793 (Src)
  09158 Development and regeneration
   04360 Axon guidance
    110317793 (Src)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110317793 (Src)
   05207 Chemical carcinogenesis - receptor activation
    110317793 (Src)
   05208 Chemical carcinogenesis - reactive oxygen species
    110317793 (Src)
   05203 Viral carcinogenesis
    110317793 (Src)
  09162 Cancer: specific types
   05219 Bladder cancer
    110317793 (Src)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110317793 (Src)
   05168 Herpes simplex virus 1 infection
    110317793 (Src)
   05163 Human cytomegalovirus infection
    110317793 (Src)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110317793 (Src)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110317793 (Src)
   05152 Tuberculosis
    110317793 (Src)
   05100 Bacterial invasion of epithelial cells
    110317793 (Src)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110317793 (Src)
   05418 Fluid shear stress and atherosclerosis
    110317793 (Src)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110317793 (Src)
   01522 Endocrine resistance
    110317793 (Src)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110317793 (Src)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110317793 (Src)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110317793 (Src)
Protein kinases [BR:mpah01001]
 Non-receptor tyrosine kinases
  SRC family
   110317793 (Src)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    110317793 (Src)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    110317793 (Src)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    110317793 (Src)
  Macropinocytosis
   Kinases
    110317793 (Src)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 ABC1 Haspin_kinase
Other DBs
NCBI-GeneID: 110317793
NCBI-ProteinID: XP_021048223
Ensembl: MGP_PahariEiJ_G0026020
LinkDB
Position
3
AA seq 541 aa
MGSNKSKPKDASQRRRSLEPAENVHGAGGAFPASQTPSKPASADGHRGPNAAFAPPAAEP
KLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKVD
VREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTF
LVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSK
HADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRV
AIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKG
ETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVL
DQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGEN
L
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggacgccagccagcggcgccgcagcctggagccc
gcggaaaacgtgcacggggcagggggcgccttcccggcctcacagacaccaagcaagccc
gcctccgccgacggccaccgcgggcccaacgccgccttcgcgccgcccgcggcagagccc
aagctctttggaggcttcaactcctcggacaccgtcacctccccgcagagggccgggcct
ctggcaggtggggtgaccacctttgtggccctctatgactatgagtcacggacagagact
gacctgtccttcaagaaaggggagcggctgcagattgtcaataacacgaggaaggtggat
gtcagagagggggactggtggctggcacactcactgagcacgggacagaccggttacatc
cccagcaactatgtggcgccctccgactccatccaagccgaggagtggtactttggcaag
atcactagaagggaatcagagcggctactgctcaacgccgagaacccgagagggaccttc
ctcgtgagggagagtgagaccacaaaaggtgcctactgcctctccgtatccgacttcgac
aatgccaagggcctaaatgtgaaacactacaagatccgaaagctggacagcggcgggttc
tacatcacctcccgcacccagttcaacagcctacagcagctcgtggcttactactccaaa
catgctgatggcctgtgtcaccgcctcactactgtctgtcccacatccaagcctcagacc
cagggcctggccaaggatgcgtgggagatcccccgggagtccctgcggctggaggtcaag
ctgggccagggttgctttggagaggtgtggatggggacctggaacggcaccacgagggtt
gccataaaaaccctgaagccaggtaccatgtccccagaggccttcctgcaggaggcccaa
gtcatgaagaaactgaggcacgagaagctggtgcagctgtatgccgtggtgtcagaagaa
cccatttacattgtgacagagtacatgaacaaggggagtcttctggactttctcaagggg
gaaactggcaaatacttgcggctaccccagctggtggacatgtctgctcagatcgcttca
ggcatggcctatgtggagcggatgaactatgtgcaccgggacctccgagctgccaatatc
ctagtgggggagaacctggtgtgcaaagtggccgactttgggctggcccggctcatagaa
gacaacgaatacacagcccggcaaggtgccaaattccccatcaagtggaccgcccctgaa
gctgctctgtacggcaggttcaccatcaagtcggatgtgtggtcctttggtatcctgctg
acagagctcaccactaagggaagagtgccctatcctgggatggtgaaccgtgaggttctg
gaccaggtggagcggggctaccggatgccttgtccccctgagtgccctgagtccctgcat
gacctcatgtgccagtgctggcggaaggagcccgaggagcggcccaccttcgagtacctg
caggccttcctggaagactactttacgtccactgagccgcagtaccagcccggggagaac
ttatag

DBGET integrated database retrieval system