KEGG   Mus pahari (shrew mouse): 110317810
Entry
110317810         CDS       T05929                                 
Symbol
Itga8
Name
(RefSeq) integrin alpha-8 isoform X1
  KO
K06584  integrin alpha 8
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04512  ECM-receptor interaction
mpah04514  Cell adhesion molecules
mpah04810  Regulation of actin cytoskeleton
mpah05165  Human papillomavirus infection
mpah05410  Hypertrophic cardiomyopathy
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110317810 (Itga8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110317810 (Itga8)
   04514 Cell adhesion molecules
    110317810 (Itga8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110317810 (Itga8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110317810 (Itga8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110317810 (Itga8)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110317810 (Itga8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110317810 (Itga8)
   05414 Dilated cardiomyopathy
    110317810 (Itga8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110317810 (Itga8)
Cell adhesion molecules [BR:mpah04515]
 Integrins
  Integrin alpha subunits
   110317810 (Itga8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 110317810
NCBI-ProteinID: XP_021048260
Ensembl: MGP_PahariEiJ_G0024638
LinkDB
Position
3:complement(109138..291508)
AA seq 1062 aa
MSAGTHRGPPGNRAPPFARLCCVSAALGMLWSPASLAFNLDVDKLTVYSGPEGSYFGYSL
DFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPSERSAQCKQIPFDTTNNRKIRV
NGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPNPAKDPVGTCYVAIQNFSAY
AEHSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITVSIADIIANYS
FKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVGQVY
LYLQASALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLI
YNGNSEGLHSKPSQVLQGIWGSQTIPSGFGFSLRGDADIDKNDYPDLLVGAFGKGKVAVY
RARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVACFSVRVCASIAGQSISNTIALLAE
VQLDFLKQKGAIKRTLFLHNHQSHLTFPFVMKQQKSPHCQDFMVYLRDETEFRDKLSPIN
ISLNYSLDDSTFKDGLEVKPILNHYRDNVVTEQAHILVDCGEDNLCVPDLKLSARPDKHQ
IIIGDENHLMLIINARNEGEGAYEAELFVIIPEEADYVGIERNSKGLRPLSCEYKMENVT
RMVVCDLGNPMVTGTNFSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFASVQINI
TAVAQVEIRGVSHPPQIVLPIHNWEAEKKPHKEEEVGPLVEHIYELHNIGPSTIGESILD
VGWPFSARDEFLLYIFHLQTLGPLRCQTNPEINPQDIKPASSPEDTPELSAFLRNATIPH
LVRKRDVPVVHLHRQSPARILNCTNIDCLQISCAVGRLGGGESAVLKVRSRLWAHTFLKR
KNDHYALASLVSFEVKKMPYKEQPAKLPAGSTAIKTLVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQEEMTDREQLTSDKTPEA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgtctgcgggaacccaccgtggtcccccggggaaccgggcacctccgttcgcgcgtctc
tgttgcgtctcggccgcgctggggatgctgtggtcccctgcgtctctggcgttcaacttg
gatgtggacaagctcactgtgtacagtggccccgagggcagctacttcggctactcactg
gacttctacatacctgatgcgcgcacagccagtgtcttagtgggggcgcccaaagccaat
actagccagccggatatcgtagaagggggagctgtctactactgtccctggccctcagag
aggtctgcacagtgcaagcagataccgtttgacaccaccaacaacaggaaaatcagagtt
aatggaaccaaagaacctatagaatttaaatcaaaccagtggttcggagccacagtgaga
gcgcacaaaggaaaagttgtggcttgtgcccctttatatcactggagaactctgaaacct
aatccagcaaaggacccagttggcacatgctatgtagcaattcagaatttcagtgcttat
gctgagcactcaccttgtcgaaacagcaatgctgatcctgaaggccaaggttactgccag
gcggggtttagcctagacttctataagaatggagaccttatagtgggaggacctggaagc
ttttactggcaaggtcaggtgatcactgtcagtatagcagacatcattgcaaattactca
ttcaaggatattttacgaaaactggccgcagaaaagcagacagatgtggctccagcttcc
tatgatgacagctaccttggatattcagttgctgctggagaattcactggtgactctcag
caagaattggttgctgggattccaagaggagcacagaactttggatatgtctccatcatt
aactccacagacatgaccttcattcagaattttactggtgagcagatggcatcttatttt
ggatatactgttgtggtatcagatgttaacaatgatggcatggatgacatattggttggg
gcacctctctttatggagcgagaatttgaaagtaaccctagagaagtgggacaggtctac
ctgtacctacaagccagcgccctcctcttccaagacccacaggtcctcactggcacagag
acatttgggagattcggtagctctgtggcccacttgggggacctgaaccaagatggatac
aatgacatcgccatcggtgtgccctttgcaggcaaggatcaacgaggtaaagtcctcatt
tataatggaaattcagaaggcttacacagcaagccttcccaagttctgcaaggaatatgg
gggtcacagaccatcccttctggatttggcttttctctaagaggagatgcagacatagac
aagaatgattacccagatttacttgtaggggcatttggaaaaggaaaagtagctgtttac
agagcaaggccagttgtaactgtggatgcccagcttctgctgcacccaatgattatcaac
cttgaaaataaaacttgccagattccagaattcccaactcctgtagcctgcttttctgta
agagtctgtgcatctatagcaggccagagcatttcaaatacaatagccctgctggctgag
gtgcagttagatttcctgaagcaaaaaggagccatcaagcggacgctctttctccacaac
caccagtcccatctcaccttcccctttgtgatgaagcagcagaaatccccccactgtcag
gattttatggtttaccttcgggatgaaactgaattccgagataaattgtctccaatcaac
atcagcctgaactacagcttggacgattccacctttaaagatggcctggaagtgaaacca
attttgaatcactacagagacaatgtcgttactgagcaggctcacatcctggtggactgc
ggagaagacaacctatgtgttcctgacttgaagctgtcagctagaccagataagcatcag
ataattattggtgatgaaaatcacctaatgctcataataaatgcaagaaatgagggagaa
ggggcctacgaagccgaactcttcgtcatcatccctgaagaagcagattacgttgggatt
gagcgcaacagcaagggactgaggcccctgagttgtgagtacaagatggaaaacgtgacc
aggatggtggtgtgtgacctcgggaacccgatggtgactggaacaaatttttctctgggc
ctccgatttgctgttcctcgtcttgagaaaacaaatatgagcattaacttcgatctccaa
atcagaagctccaacaaggacaatcctgacagcaacttcgcaagtgtacaaatcaacatc
actgcagttgctcaggtcgaaatcagaggagtatcccaccctccacagattgttctgccc
atccacaactgggaagcagaaaagaagccacacaaagaggaggaagttggtcccttggtt
gagcatatttatgagctgcacaatattggacccagcaccatcggtgagagcattcttgac
gtgggctggccgttttctgcacgggatgagtttctcctctatatttttcatcttcaaact
ctgggacctctacgatgtcaaacaaatcctgagatcaacccacaggatataaagcctgct
tcctccccagaggatacccctgagctcagtgccttcttaagaaatgctacaattccccat
cttgtcaggaagagagatgtgccagtggtccacctccacagacagagccctgcaagaata
ctgaactgtaccaacattgactgcttgcaaatctcttgtgcagtgggtcgcctgggagga
ggtgaaagtgcagtcctgaaggtcagatcaagattgtgggcccacacgttcctcaagaga
aagaatgatcattatgctcttgcatccctggtgtcctttgaagtcaagaagatgccttat
aaagaacagccagcaaagctgccagcggggagcacagcgattaagacgttggttatttgg
gccactccgaatgtctccttctcaattccattgtgggtcataatactagcgatccttctt
ggtttgctggttctggccatcttaactttagctttatggaagtgtggattctttgataga
gcaagacctcctcaggaggaaatgacagacagggaacaactgaccagtgacaagaccccg
gaggcgtga

DBGET integrated database retrieval system