KEGG   Mus pahari (shrew mouse): 110317910
Entry
110317910         CDS       T05929                                 
Symbol
Itga4
Name
(RefSeq) integrin alpha-4
  KO
K06483  integrin alpha 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04512  ECM-receptor interaction
mpah04514  Cell adhesion molecules
mpah04640  Hematopoietic cell lineage
mpah04670  Leukocyte transendothelial migration
mpah04672  Intestinal immune network for IgA production
mpah04810  Regulation of actin cytoskeleton
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05165  Human papillomavirus infection
mpah05410  Hypertrophic cardiomyopathy
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110317910 (Itga4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110317910 (Itga4)
   04514 Cell adhesion molecules
    110317910 (Itga4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110317910 (Itga4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110317910 (Itga4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110317910 (Itga4)
   04670 Leukocyte transendothelial migration
    110317910 (Itga4)
   04672 Intestinal immune network for IgA production
    110317910 (Itga4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110317910 (Itga4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110317910 (Itga4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110317910 (Itga4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110317910 (Itga4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110317910 (Itga4)
   05414 Dilated cardiomyopathy
    110317910 (Itga4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110317910 (Itga4)
   04515 Cell adhesion molecules [BR:mpah04515]
    110317910 (Itga4)
   04090 CD molecules [BR:mpah04090]
    110317910 (Itga4)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110317910 (Itga4)
  Exosomal proteins of other cancer cells
   110317910 (Itga4)
Cell adhesion molecules [BR:mpah04515]
 Integrins
  Integrin alpha subunits
   110317910 (Itga4)
CD molecules [BR:mpah04090]
 Proteins
  110317910 (Itga4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha MGTA_C
Other DBs
NCBI-GeneID: 110317910
NCBI-ProteinID: XP_021048368
Ensembl: MGP_PahariEiJ_G0025149
LinkDB
Position
3:65143692..65216875
AA seq 990 aa
MAEEARCRPRSRGIALREAVMLLLYLGVPTGHSYNLDPENALLYQGPSGTLFGYSVVLHS
HGTKRWLIVGAPTASWLSNASVVNPGAIYRCGIRKNPNQTCEQLQLGSPSGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYMKNDNKLPTGICYGMPSDLRTELSKRM
APCYQDYVRKFGENFASCQAGISSFYTQDLIVMGAPGSSYWTGSVFVYNITTNKYKAFVD
RQNQVKFGSYLGYSVGAGHFRSPHTTEVVGGAPQHEQIGKAYIFSINESELNIIYEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGVGAVMVEMERVLVG
SDKYAARFGESIANLGDIDNDGFEDIAIGAPQEDDLRGAVYIYNGRVDGISSTYSQRIEG
RQISKSLRMFGQSISGQIDADNNGYVDVAVGAFQSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCTENGLPSVCMHLTLCFSYKGKEVPGYIVLFYNVSLDVHRKAESPSRFYFFSNGT
SDVITGSIRVSSSGEKCRTHQAFMRKDVRDILTINFARFCAYENCSADLQVSAKVGFLKP
YENKTYLAVGSMKTIMLNVSLFNAGDDAYETTLNVQLPTGLYFIKILDLEEKQINCEVTE
SSGVVKLACSLGYIYVDRLSRIDVSFLLDVSSLSRAHEDLSISVHASCENEGELDQVKDN
RLTLAIPLRYEVMLAVHGLVNPTSFVYGSSEENKPDTCMAEKLNLTFHVINTGISMAPNV
SVKIMVPNSFLPQNDKLFNIVDVQATTGQCHFKHYGRECTFAQQKGIAGTLTDIVKFLSK
TDKRLLYCMKADQHCLDFLCNFGQMESGKEASVHIQLEGRPSILEMDETSSLKFEIKATA
FPEPHPKVIELNKDENMAHVFLEGLHHQRPKRHFTIVIITSSLLLGLIVLLLISCVMWKA
GFFKRQYKSILQEENRRDSWSYVNSKSNDD
NT seq 2973 nt   +upstreamnt  +downstreamnt
atggctgaggaagcgaggtgcagaccgaggtcccgagggatcgccctccgggaagcggtg
atgctgttgttgtacttaggggtgccaaccgggcactcctacaacctggacccagagaat
gcactgctgtaccagggcccctccggcacgctctttggctactcggtggtgctgcacagc
cacgggaccaagcgctggctcatcgtgggggcgcccactgccagctggctctctaatgcc
tcagtggtcaatcctggagcgatttacagatgcgggatcagaaagaatccaaaccagacc
tgcgaacagctccagctgggtagccccagtggagagccctgtgggaagacatgcctggaa
gaaagggataaccagtggctgggggtcacgctttccagacagccaggagaaaatggatct
atcgtgacttgtgggcacaggtggaaaaatattttttacatgaagaacgataacaaactc
cccactggcatttgctacggcatgccttctgatttgcgaacagaactaagtaaaaggatg
gccccgtgttaccaagattatgtgagaaaatttggagaaaattttgcatcgtgtcaagct
ggaatatctagtttttacacacaggatttaattgtgatgggggccccgggatcatcgtac
tggactggctccgtctttgtctacaatataactacaaacaaatacaaagcatttgtagac
agacagaatcaagtaaaatttggaagctacttaggctactcagtcggagctggacatttt
cgaagtccacatactactgaagtcgtgggaggagcccctcaacacgaacagataggaaaa
gcatatatatttagcattaatgaaagtgaactgaacatcatatatgaaatgaaaggtaaa
aagcttggctcatactttggagcttctgtctgtgctgtagacctcaatgcagatggcttc
tcagatctccttgttggagctcccatgcagagcaccatcagggaggaaggaagagtattc
gtgtacatcaactctggtgtgggagctgtgatggttgaaatggaaagggtgcttgttgga
agtgacaaatatgctgcaagatttggggagtctatagcgaatcttggtgacattgacaat
gacggctttgaagatattgctattggtgcaccacaagaagatgacttgcgaggtgctgtc
tacatttacaatggccgagtggacggaatctcctccacctactcacagagaatcgaagga
cgtcaaatcagcaaatcgctaaggatgtttggacaatctatctcaggacaaattgatgca
gacaacaatggatatgttgatgtagctgttggtgcgtttcagtctgattctgcagtgttg
ctaaggacaaggcctgtagtgattgttgaagcatctttaagccatcctgagtctgtaaat
aggacaaaatttgactgtactgaaaatggacttccgtctgtatgcatgcatcttacattg
tgtttctcatataaaggcaaagaggtcccagggtacatcgttttgttttacaatgtgagc
ttggatgtgcacaggaaggcagagtctccgtcaagattttatttcttctctaatgggact
tctgacgtgattacaggaagcatacgagtttcaagcagtggagagaaatgtaggacacac
caggcattcatgcggaaagatgtgcgagacatcctcaccataaactttgcaaggttttgt
gcctatgaaaattgctctgctgatctgcaagtttctgcaaaagttggatttttgaagcca
tatgaaaataaaacgtatcttgctgttgggagcatgaagaccataatgctaaacgtgtcc
ttgttcaacgctggagatgatgcttatgaaaccactctgaatgtccaactccccacaggc
ctttacttcattaagatcttagacctggaagagaaacaaataaactgcgaagtgacagag
agctcaggcgtagtgaaacttgcctgcagccttggttacatatatgtggatcgtctctca
aggatagatgttagctttctcctggacgtgagctcactcagcagggcacatgaggacctc
agcatcagcgtgcatgcctcctgtgaaaacgagggcgaattggaccaagtgaaggacaac
agactgaccttagcgatacctctaaggtatgaggttatgctggctgttcatgggcttgtg
aacccaacttcatttgtgtatggatccagtgaagaaaacaaaccagacacatgcatggcc
gagaagctgaacctcactttccatgttataaacactggcattagcatggctccaaatgtt
agtgtgaaaattatggtaccaaattcttttctccctcaaaatgataagttgttcaacatt
gtggatgtccaggcaactactgggcaatgccattttaaacactatggaagagagtgtaca
tttgcacagcaaaaaggcatagcgggtaccttgaccgatatagtcaaattcctatcaaag
actgataagagactcctgtattgcatgaaagctgaccaacactgtttagatttcttatgc
aatttcgggcaaatggaaagtgggaaggaagccagtgttcacattcagctggaaggcagg
ccatccatcttggaaatggatgagacctcatcactcaagtttgaaataaaagcaacagct
tttccagagccacacccaaaagttattgaactaaataaggatgaaaacatggcccatgtt
ttcttggaagggctccatcatcaaagacccaaacggcatttcaccatcgttattattacc
agcagcttgctacttggacttattgtacttttgttaatttcatgtgttatgtggaaggct
ggattctttaaaagacagtacaaatctatcctacaagaagaaaacaggagagacagctgg
agttatgtcaacagcaaaagcaatgatgactga

DBGET integrated database retrieval system