KEGG   Mus pahari (shrew mouse): 110318229
Entry
110318229         CDS       T05929                                 
Symbol
Itgav
Name
(RefSeq) integrin alpha-V isoform X1
  KO
K06487  integrin alpha V
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04512  ECM-receptor interaction
mpah04514  Cell adhesion molecules
mpah04810  Regulation of actin cytoskeleton
mpah04919  Thyroid hormone signaling pathway
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05222  Small cell lung cancer
mpah05410  Hypertrophic cardiomyopathy
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
mpah05414  Dilated cardiomyopathy
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110318229 (Itgav)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110318229 (Itgav)
   04514 Cell adhesion molecules
    110318229 (Itgav)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110318229 (Itgav)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110318229 (Itgav)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110318229 (Itgav)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110318229 (Itgav)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110318229 (Itgav)
   05205 Proteoglycans in cancer
    110318229 (Itgav)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110318229 (Itgav)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110318229 (Itgav)
   05165 Human papillomavirus infection
    110318229 (Itgav)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110318229 (Itgav)
   05410 Hypertrophic cardiomyopathy
    110318229 (Itgav)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110318229 (Itgav)
   05414 Dilated cardiomyopathy
    110318229 (Itgav)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110318229 (Itgav)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110318229 (Itgav)
   04515 Cell adhesion molecules [BR:mpah04515]
    110318229 (Itgav)
   04090 CD molecules [BR:mpah04090]
    110318229 (Itgav)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110318229 (Itgav)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110318229 (Itgav)
  Exosomal proteins of epithelial cells
   110318229 (Itgav)
Cell adhesion molecules [BR:mpah04515]
 Integrins
  Integrin alpha subunits
   110318229 (Itgav)
CD molecules [BR:mpah04090]
 Proteins
  110318229 (Itgav)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha LYRIC DctQ
Other DBs
NCBI-GeneID: 110318229
NCBI-ProteinID: XP_021048735
Ensembl: MGP_PahariEiJ_G0025165
LinkDB
Position
3:69148879..69231579
AA seq 1052 aa
MAAPGRLLLRPRPGGLLLLLPGLLLPLAHAFNLDVESPAEYAGPEGSYFGFAVDFFEPST
SSRMFLLVGAPKANTTQPGIVEGGQVLKCECSSSRRCQPIEFDSTGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVILGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVTVSLQRAVGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQI
LEGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVTVNAGLEVY
PSILNQDNKICPLPGTALKVSCFNVRFCLKADGKGTLPRKLNFQVELLLDKLKQKGAIRR
ALFLHNRSPGHSKTMTVFRGGQMQCEELVAYLRDESEFRDKLTPITIFMEYRLDQRMAAD
ATGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLTVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLKIQSSNSFDNVSPVVSYKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEYKENPETEEDVGPIVQHIYELRNNGPSSFSKAILNLQWPYKYNNNTLLY
ILHYDIDGPMNCTADTEINPLRIKVCNPCLSLQTPEKNDTAAGPGERSHLLTKRDLTLGE
GDVHTLGCGIAKCLQITCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASF
NIIEFPYKNLPIEDLFNSTLVTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMY
RMGFFKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3159 nt   +upstreamnt  +downstreamnt
atggctgctcccgggcggctgctgctacgccctcgccccggcggcctcctgctgctgctg
cccggtctcctgctgcccctcgcccacgccttcaacctggacgtcgaaagtcccgccgag
tacgccggccccgagggaagttacttcggattcgccgtggacttcttcgagcccagcacg
tcctccaggatgtttctcctggtgggagcccccaaagcaaacacaacccagcctgggatt
gtagaaggagggcaagttctcaaatgtgaatgctcatccagccgccggtgccagcccatt
gaatttgactcaacaggcaatcgagattatgccaaagatgacccactggagtttaagtcc
caccagtggtttggagcctccgtgaggtcaaagcaggataaaatcttggcctgtgctcca
ttgtaccactggaggactgagatgaagcaggagagagagccagttggaacctgctttctt
caggatggcacaaagaccgttgagtatgctccatgcaggtcaaaaaatattgatgctgat
ggccagggattttgtcaaggaggattcagcattgattttactaaagccgacagagtaatt
ctcggtggtcctggtagcttttattggcaaggtcagctcatttcggaccaagtggcagaa
atcatatctaaatatgacccaaatgtctacagcatcaaatataataaccaattagcaaca
cgaactgcacaagcaatttttgatgacagttatttgggttactctgtggccgtgggagac
ttcaatggtgacggcattgaagattttgtctcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaaaaatatgtcctctttacacaattttactggtgaa
cagatggctgcatattttggattttctgtagctgctactgacattaatggggatgattac
gcagatgtgtttattggagcccccctgttcatggaccgaggttccgatggaaaactccag
gaggtcggccaggtcacagtgtctctgcagagagcagtgggagacttccagactacaaag
ctgaacggctttgaggtttttgccaggtttggaagtgccatagctccattgggagacctg
gaccaggatggcttcaatgatattgcaattgctgctccatatggtggtgaagataaaaag
ggacttgtttatatcttcaatggaagatccacaggcttgaattcagtgccatctcaaatc
ctcgaggggcagtgggctgctcagagcatgcctccaagctttggctattcaatgaaggga
gctacagatgtagacagaaatggatatccagacttagttgtaggagcttttggtgtggat
cgagctgtcttatacagagccagacccgttgtcaccgtgaatgctggccttgaagtgtac
cctagcattttaaatcaagacaataagatctgcccgttgcctgggacagctctcaaggtt
tcctgttttaatgtcagattctgcttaaaggcggatggcaagggaacccttcctcggaag
ctcaacttccaggtggagcttcttttggataaactcaagcagaagggagccatccgacga
gcactgtttctccataacaggtccccgggccactctaagaccatgactgttttcaggggg
ggacagatgcagtgtgaggaactggtcgcctatcttcgggatgaatctgaatttagagac
aagctcactcccatcaccatttttatggagtatcggttggaccagagaatggctgctgat
gccacaggcttgcagcccatcctgaaccagttcactccggccaatgtcagtcggcaggct
catattctacttgactgtggtgaagacaatgtctgtaaacctaaactggaagtttctgta
gatagtgatcaaaagaagatctatattggggacgacaaccctctgacactgactgtgaag
gcgcagaatcaaggggaaggcgcctatgaagctgagctcatagtttccattccgccacag
gccgacttcatcggggttgtccggaacaacgaagccttagcaagactgtcctgtgcattt
aagacagaaaaccaaacccggcaggtggtgtgcgaccttggaaacccgatgaaggctggg
actcaactgcttgctggccttcgtttcagcgtgcaccagcagtccgagatggatacttcg
gtgaagttcgacttgaaaatccagagctctaattcttttgacaacgtaagcccggttgta
tcttacaaggttgaccttgccgttttggctgctgtggagataagaggagtttcaagtcca
gatcatatctttcttccaattccaaattgggagtacaaggaaaaccctgagactgaagaa
gacgttggacctattgttcagcacatttatgagctgagaaacaatggtccaagttcattc
agcaaggcaattctaaatctccagtggccttacaaatacaacaataacactttgttgtac
attcttcattacgacattgacgggccaatgaactgtacggcagatacggagatcaaccct
ttgagaattaaggtatgtaatccatgtctgtctttacagacacccgaaaagaatgacaca
gcggctggaccaggagaaaggagtcatctcctcaccaagcgggatctcaccctcggtgag
ggagatgttcacactttgggttgtggaatcgctaagtgcttgcagatcacctgccaggtt
ggtcgactggatagaggcaagagtgcaatcctgtacgtgaaatctctgctgtggaccgag
acgttcatgaataaggagaaccagaaccattcctattccctgaagtcttctgcttccttt
aatatcatagaattcccttacaagaaccttccgattgaggatctcttcaactctacacta
gtcaccacgaacatcacctggggcattcagccggcgcccatgcctgtgcctgtgtgggtg
atcatcttggcagttctcgcagggctgctgttactggctgtgttggtgtttgtaatgtac
aggatgggctttttcaaacgtgtccgaccacctcaagaagagcaagaaagagaacagctt
cagcctcatgagaatggcgaaggaaactctgaaacctaa

DBGET integrated database retrieval system