Mus pahari (shrew mouse): 110318630 Help Entry 110318630         CDS       T05929                                  Symbol Bcl2l1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mpah  Mus pahari (shrew mouse) Pathway mpah01521   EGFR tyrosine kinase inhibitor resistance mpah01524   Platinum drug resistance mpah04014   Ras signaling pathway mpah04064   NF-kappa B signaling pathway mpah04115   p53 signaling pathway mpah04137   Mitophagy - animal mpah04140   Autophagy - animal mpah04151   PI3K-Akt signaling pathway mpah04210   Apoptosis mpah04215   Apoptosis - multiple species mpah04621   NOD-like receptor signaling pathway mpah04630   JAK-STAT signaling pathway mpah05012   Parkinson disease mpah05014   Amyotrophic lateral sclerosis mpah05022   Pathways of neurodegeneration - multiple diseases mpah05145   Toxoplasmosis mpah05162   Measles mpah05166   Human T-cell leukemia virus 1 infection mpah05168   Herpes simplex virus 1 infection mpah05170   Human immunodeficiency virus 1 infection mpah05200   Pathways in cancer mpah05202   Transcriptional misregulation in cancer mpah05212   Pancreatic cancer mpah05220   Chronic myeloid leukemia mpah05222   Small cell lung cancer mpah05225   Hepatocellular carcinoma mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110318630 (Bcl2l1)    04630 JAK-STAT signaling pathway     110318630 (Bcl2l1)    04064 NF-kappa B signaling pathway     110318630 (Bcl2l1)    04151 PI3K-Akt signaling pathway     110318630 (Bcl2l1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110318630 (Bcl2l1)    04137 Mitophagy - animal     110318630 (Bcl2l1)   09143 Cell growth and death    04210 Apoptosis     110318630 (Bcl2l1)    04215 Apoptosis - multiple species     110318630 (Bcl2l1)    04115 p53 signaling pathway     110318630 (Bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110318630 (Bcl2l1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110318630 (Bcl2l1)    05202 Transcriptional misregulation in cancer     110318630 (Bcl2l1)   09162 Cancer: specific types    05212 Pancreatic cancer     110318630 (Bcl2l1)    05225 Hepatocellular carcinoma     110318630 (Bcl2l1)    05220 Chronic myeloid leukemia     110318630 (Bcl2l1)    05222 Small cell lung cancer     110318630 (Bcl2l1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110318630 (Bcl2l1)    05170 Human immunodeficiency virus 1 infection     110318630 (Bcl2l1)    05162 Measles     110318630 (Bcl2l1)    05168 Herpes simplex virus 1 infection     110318630 (Bcl2l1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110318630 (Bcl2l1)   09164 Neurodegenerative disease    05012 Parkinson disease     110318630 (Bcl2l1)    05014 Amyotrophic lateral sclerosis     110318630 (Bcl2l1)    05022 Pathways of neurodegeneration - multiple diseases     110318630 (Bcl2l1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110318630 (Bcl2l1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110318630 (Bcl2l1)    01524 Platinum drug resistance     110318630 (Bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mpah01009]     110318630 (Bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpah03036]     110318630 (Bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mpah02000]     110318630 (Bcl2l1) Protein phosphatases and associated proteins [BR:mpah01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      110318630 (Bcl2l1) Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     110318630 (Bcl2l1) Transporters [BR:mpah02000]  Other transporters   Pores ion channels [TC:1]    110318630 (Bcl2l1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  110318630 NCBI-ProteinID:  XP_021049467 Ensembl:  MGP_PahariEiJ_G0025916 LinkDB All DBs Position 3:complement(135149025..135198517) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggaactggtggtcgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtcgaagagaataggactgaggccccagaagaa actgaagcagaaagggagacccccagtgccatcaatggcaacccatcctggcacctggcg gatagccccgcggtgaatggagccactggccacagcagcagtttggatgcgcgggaggtg atccccatggcagcagtgaagcaagcgctgagagaggctggcgatgagtttgaactgcgg taccggagagcgttcagtgatctaacatcccagcttcatataaccccagggaccgcgtat cagagctttgagcaggtagtgaatgaactctttcgggatggagtaaactggggtcgcatc gtggcctttttctcctttggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaagttggatggccacctatctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggatctctacgggaacaatgcagca gcggagagtcggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcactcttcagtcggaagtga

DBGET integrated database retrieval system