Mus pahari (shrew mouse): 110318701 Help Entry 110318701         CDS       T05929                                  Symbol Urm1 Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:mpah00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     110318701 (Urm1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:mpah03016]     110318701 (Urm1)    04121 Ubiquitin system [BR:mpah04121]     110318701 (Urm1) Transfer RNA biogenesis [BR:mpah03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     110318701 (Urm1) Ubiquitin system [BR:mpah04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    110318701 (Urm1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  110318701 NCBI-ProteinID:  XP_021049582 Ensembl:  MGP_PahariEiJ_G0024829 LinkDB All DBs Position 3:17094355..17114791 Genome browser AA seq 101 aa AA seqDB search MAAPLCVEVEFGGGAELLFDGVKKHQVTLPGQEEPWDIRNLLVWIKKNLLKERPELFIQG DSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcggcgcccttatgtgtggaggtggagttcggaggtggtgcggagctcctgtttgat ggagtaaaaaagcatcaagtcaccttgcctgggcaggaggaaccctgggatatacggaac ctccttgtctggatcaagaagaatttgctaaaagagcgaccagagctgttcatccaggga gacagtgtgcggccaggaatcctggtgctgattaatgatgccgactgggaactgctgggg gagctggactaccagcttcaggaccaagacagcatcctcttcatctccacactgcacggc ggctga

DBGET integrated database retrieval system