KEGG   Mus pahari (shrew mouse): 110318833
Entry
110318833         CDS       T05929                                 
Symbol
Serping1
Name
(RefSeq) plasma protease C1 inhibitor
  KO
K04001  C1 inhibitor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05133  Pertussis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110318833 (Serping1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    110318833 (Serping1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110318833 (Serping1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110318833 (Serping1)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I4: serpin family
   110318833 (Serping1)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110318833 (Serping1)
SSDB
Motif
Pfam: Serpin Nrap_D2
Other DBs
NCBI-GeneID: 110318833
NCBI-ProteinID: XP_021049778
Ensembl: MGP_PahariEiJ_G0025180
LinkDB
Position
3:complement(70084167..70094328)
AA seq 505 aa
MASTLTPLTLLLLLLLAGDRAFSDPEATSHSTEDPLEAWAQSRESFPERDDFWSPPEPTV
QPSTWPTTSVAIKITNDTMGKVANESFSQHSQPAAQLPSDSPGPPPLNSSSQPSTASDLP
TQAPTEPFCPEPLAQCSDSDRGSSEATLSGALTDFSVKLYHAFSATKMAETNMAFSPFSI
ASLLTQVLLGAGDNTKSNLESILSYPKDFACVHQALKGFSSKGVTSVSQIFHSPDLAIRD
TYVNASQSLYGSSPRVLGPDSAANLELINTWVAENTNHKIRELLDGLPSDTRLILLNAVY
LSAKWKIAFEQKKMKVPFFYKNSAIKVPMMSSKKYPVAQFNDQTLKAKVGQLQLSHNLSF
VIILPQIPKHQLKGIEEALNPTVFKAIMKKLELSKFQATYLTMPRIKVKSSQDMLSVMEK
LEFFDFSYDLNLCGLTEDPDLQVSAMKHETVLELTETGVEAAAASAISLARNLLVFEVNQ
PFLFLLWDQQHKFPVFMGRVYDPMG
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcctccacgctgaccccactgaccctcctgctgctgctgctgctggctggggacaga
gccttctcggatcccgaagctaccagccacagcaccgaagacccactggaggcttgggcg
caaagcagagagagcttccctgaaagagatgacttctggagtcctcctgagcctacagta
cagccctctacctggccaaccaccagtgtagctatcaaaataacaaatgacaccatgggt
aaagtggccaacgagtccttcagccagcacagccagccagctgctcagctaccctcagat
tcccccggcccgccccctctgaattcttccagccagccctccacagcctcagatcttccc
acccaggctcctactgaacccttctgcccggagccacttgcccagtgctctgattcagac
agaggctcctcagaggctacgctctcaggggctttgacagatttctccgtgaagctctac
cacgccttctcagctaccaagatggctgagaccaacatggccttttccccattcagcatt
gccagcctcctcacgcaggttcttcttggggctggagacaacaccaagagcaacttggag
agcatcctttcctaccccaaggattttgcctgtgtccaccaagcactaaagggcttttca
tccaaaggtgtcacttctgtgtctcagattttccacagcccagatctggccataagggac
acctatgtgaatgcctctcagagcctgtatggaagcagccccagagtcctgggcccagac
agcgctgctaacttagaactcatcaacacctgggtggctgagaacaccaaccacaagatc
cgtgagctgctggacggcctgccctctgacacccgcctcatccttctcaatgctgtctac
ttgagtgccaagtggaagatagcatttgaacaaaaaaagatgaaggtgcctttcttctac
aaaaactctgcgattaaagtgcccatgatgagtagcaaaaagtaccctgtggcccaattc
aatgaccagactctgaaggccaaggtgggacaactgcagctctctcacaacctgagcttt
gtgatcatactaccccagatcccaaagcaccaacttaaaggcatagaagaggctctcaac
cccactgtcttcaaggccatcatgaagaagctggagctgtccaaattccaggccacttac
ctgacaatgcctcgtataaaagtaaagagcagccaagacatgctgtcagtcatggagaaa
ctggaattctttgacttctcttacgatctcaacctgtgcgggctgaccgaggacccagat
cttcaggtgtctgccatgaaacacgagacggtgctggaactgacagagaccggcgtggaa
gcagctgcagcctccgccatctccttggcccgaaacttgctcgtctttgaggtgaaccaa
cctttcctcttcctgctctgggaccagcaacacaagttcccagtcttcatgggtcgtgta
tatgaccccatgggttga

DBGET integrated database retrieval system