KEGG   Mus pahari (shrew mouse): 110318921
Entry
110318921         CDS       T05929                                 
Symbol
Lrrc4c
Name
(RefSeq) leucine-rich repeat-containing protein 4C
  KO
K07523  netrin-G1 ligand
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04360  Axon guidance
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110318921 (Lrrc4c)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110318921 (Lrrc4c)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 ig V-set LRR_9 Ig_2 LRR_1 LRRNT Ig_6 Herpes_gE_N Syndecan
Other DBs
NCBI-GeneID: 110318921
NCBI-ProteinID: XP_021049924
Ensembl: MGP_PahariEiJ_G0025435
LinkDB
Position
3:81178860..82370672
AA seq 640 aa
MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
ELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQ
GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
NPWNCNCDILWLSWWIRDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPP
ADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTP
VIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMA
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNS
YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgttgaacaagatgaccttacatccacagcagataatgataggtcctaggtttaacagg
gccctatttgaccccctgcttgtggtgctgttggctcttcaacttcttgtggtggctggt
ctggttcgggctcaaacctgcccttcggtgtgctcttgtagcaaccagttcagcaaagtg
atttgtgttcggaaaaaccttcgtgaagttcctgatggcatctccaccaacacaaggctg
ctgaacctccatgagaaccaaatccagatcattaaagtgaacagcttcaagcatttgagg
cacttggaaatcctccagctgagcaggaaccatattcgaaccattgaaatcggggccttc
aatggtctggccaacctcaacaccctggaactctttgacaatcgtcttactaccataccg
aatggagcttttgtatatttgtctaaactgaaggagctctggttgaggaacaaccctatt
gaaagcatcccttcctatgcttttaatagaatcccttctttgcgccgcctggacttaggg
gaattgaaaaggctttcatacatctcagaaggtgcctttgaaggtctgtccaacttgagg
tatttgaaccttgccatgtgcaacctccgggaaatccctaacctcacaccgctcatcaaa
ctagacgagctagatctttctgggaaccatttatctgcaatcaggcctggctcttttcag
gggttgatgcaccttcaaaaactgtggatgatacagtctcagattcaagtgattgaacgg
aatgcctttgataaccttcagtcactagtggagataaacttggcacacaacaatctaaca
ttattgcctcatgacctcttcacacccttgcatcatctagagaggatacacctccatcac
aacccgtggaactgtaactgtgacatcctgtggctcagctggtggataagagacatggcc
ccctccaacacagcttgttgtgccaggtgtaacactccccccaacctgaaagggaggtac
atcggagaactggatcagaattattttacatgctatgctcccgtaattgtggagccccct
gcagacctcaatgtcactgaaggcatggcagctgagctgaaatgtcgggcatctacttcc
ctgacttctgtctcttggattactccaaatggaacagtcatgacccacggggcatacaaa
gtgcggatagctgtgctcagcgacggtactttaaatttcacaaatgtaactgtacaagac
acaggcatgtacacatgtatggtgagtaattctgttggcaacaccactgcttctgccacc
ttgaatgttactgcggcaaccactactccgttctcttacttttcaactgtaacagtagag
actatggaaccttctcaggatgaggcacggaccacagataacaatgtgggccccactcca
gtgatcgattgggagaccaccaatgtaaccacatctcttacgccacagagcacaaggtcg
acagaaaaaacattcaccatcccagtaactgacatcaacagcggaatcccaggaattgat
gaggtcatgaaaacaaccaaaatcattattgggtgttttgtggccatcacactcatggct
gccgtgatgctggtcattttctacaagatgaggaaacagcaccatcggcaaaaccaccat
gctccaacaaggactgttgaaatcattaacgtggatgatgagatcactggggacacgccc
atggaaagccacctgcccatgcctgcgattgagcatgagcacctaaaccactataactct
tacaaatctcccttcaaccacacaacaacagtaaacacaataaattcaatacacagttca
gtgcatgaaccgttattgatccgaatgaactctaaagacaatgtacaagagactcagata
taa

DBGET integrated database retrieval system