KEGG   Mus pahari (shrew mouse): 110319037
Entry
110319037         CDS       T05929                                 
Symbol
Siglec1
Name
(RefSeq) sialoadhesin
  KO
K06548  sialoadhesin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110319037 (Siglec1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110319037 (Siglec1)
   04091 Lectins [BR:mpah04091]
    110319037 (Siglec1)
CD molecules [BR:mpah04090]
 Proteins
  110319037 (Siglec1)
Lectins [BR:mpah04091]
 I-type lectins (Siglecs)
  110319037 (Siglec1)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set Ig_4 C2-set_2 Ig_5 C1-set Izumo-Ig
Other DBs
NCBI-GeneID: 110319037
NCBI-ProteinID: XP_021050095
Ensembl: MGP_PahariEiJ_G0025763
LinkDB
Position
3:complement(114193213..114211639)
AA seq 1703 aa
MHLGTGMCVLFSLLLLASVFSVGQTTWGVSSPKNVEGLTGSCLLIPCIFSYPADVPVPNG
ITAIWYYDYSGKRQVVIHSGDPKLVDERFRGRAELMGNMGHKVCNLLLKDLKPEDSGTYN
FRFEISDSNRWSDVKGTTVTVTKDPSPPTITIPKELREGVEGNFNCSTPYLCLQEKQVNL
QWQGQDPTHSVTSSFQSLEPTGVYHQTTLHMVLSWQDHSRTLLCQFSLGAHSSRKEVYLQ
VQHAPKGVEILLSSSGRNILPGDPVTLTCRVNSSYPAVRAVQWARDGVDLGAEGHVLRLS
SAAWNDSGVYTCQATNDVGSLVSPPLSLHVFMAEIKMNPAGPVLENETVTLLCSTPKEAP
QELRYSWYKNHILLEDAHASTLRLPAVTRADTGFYFCEVQNAQGSERSSPLSVVVRYPPL
TPDLTTFLETQAGLVGIFQCSVVSEPLATVVLSHGGLMLASSSGENDFNPRFKISSAPNS
LRLEIRDLQPADSGEYTCLATNSLGNSMSSIDFYANVARLLISPSAEVVEGQAVTLSCRS
GLSPAPDTRFSWYLNGALLLEGSSSSLLLPAASSTDAGSYYCRTQAGPNTSGPSLPTVLT
VFYPPRKPTFTARLDSDTSGVGDGQRGILLCHVDSDPPAQLRLLHKGRVVATSLPSRCGS
CSQRTKVIRASNSLHVEIQKPVLEDEGMYLCEASNTLGNSSASASFNAKATVLVITPSNT
LREGTEANLTCNVSQEVAVSPANFSWFRNGVLWTQGPLKTVRLQPVARADAAVYACRLLI
EDGAQLSASVVLSVLYAPDPPKLSALLDVGQGHMAVFICTVDSYPLAHLSLFHGDHLLAT
NLEPQRPSHGRIQVKATANSLQLEVRELGLEDSGNYHCKATNVLGSANSSLFFQVRGAWV
QVLPSPELREGQAVVLSCQVPTGVPEGTTYSWYQDGRPLQDSTSSTLRIAAISLRQAGAY
HCQAQAPDTATASLAAPVSLRVSYTPRHVTLSALLSTGPERLGHLVCSVQSDPPAQLRLF
HQNRLVASTLQGTEELASSNPRLHVTVLPNELRLQIHFPELEDDGTYTCEASNTLGQASA
AADFDAQAVHVAVWPNATVQEGQQVNLTCLVWSTHQDSLSYTWYKGGQRLLGARSISLTS
VTVLDATSYRCGVGLPGHAPHLSRPVTLDVLYAPRSLRLTYLLETQGRQLALVLCTVDSR
PPARLTLSHGDQLLASSTEASVPNTLRLELQDPRPSNEGLYSCSAHSPLGKANTSLELRL
EGVRVKMNPSGTVPEGEPVTVTCEDPAALSPTLYAWFHNGHWLQEGPASSLQFPVTTRAH
AGAYFCQVHDVQGTRSSRPASLQILYAPRDAVLSSFRDSRTSLMVVIQCTVDSEPPAEMV
LSHNGKVLAASHEHHSSASGIGHIQVARNALRLQVQDVTVGDGNTYVCTARNTLGSISTT
QRLLTETDIRVTAEPGLDVPEGTALNLSCLLPGGSRPMGNSSFTWFWNRHRLHSAPVPTL
SFTPVLRAQAGLYHCRADLPTGATTSAPVMLRVLYPPKTPTLTVFVEPQGGHRGILDCQV
DSEPLAILTLHQGSQLVASNQPHGAPAQPHIRVTAPPNALRVDIEELGPSNQGEYVCTAS
NALGSASASAYFGTRALHQLQLFQRLLWVLGFLAGFLCLLLGLVACHTWRKKSSTKLNEN
ENEDSAEMATKKDTIQEEVVAAL
NT seq 5112 nt   +upstreamnt  +downstreamnt
atgcacctgggaactgggatgtgtgtcctgttctccctgctcctgctggcctctgtcttc
tcagtaggccagaccacatggggtgtctccagtcccaagaatgtggagggcttgacagga
tcttgcctgctcattccctgcatcttcagctaccctgctgatgtcccagtgcccaatggc
atcacagccatctggtactatgactactcgggcaagaggcaggtggtaatccactcaggg
gaccccaagttggtggacgagcgcttcaggggccgagctgaactgatggggaacatgggt
cacaaggtgtgcaacctgttgctcaaagacctgaagcccgaagactctggcacctacaac
ttccgctttgagatcagtgatagcaaccgctggtcagatgtcaaaggcaccacagtcact
gtgacaaaggatcccagcccccccactattaccattcccaaggagctgcgtgaaggcgtg
gaggggaacttcaattgttccacaccctacctatgcctgcaggagaagcaagtaaacctt
cagtggcaaggccaggaccccacccactctgtcacctccagcttccagagcctcgagccc
actggcgtctatcaccagacgactctacatatggtcctatcctggcaggaccacagtcgg
accctgctctgccagttctcattgggcgcgcacagtagtcggaaagaggtttacctgcaa
gtgcagcatgcccccaaaggtgtggagatcctccttagctcctcagggaggaacatcctt
ccaggggatccagtcacgctcacctgcagagtgaacagcagctatcctgccgtccgtgct
gtgcagtgggccagggatggagtggaccttggagctgagggacatgtgctgaggctgtcc
tcagcagcctggaatgattctggggtctacacctgccaagcaacaaatgatgtgggctct
ctggtgtcacccccgctcagcctccatgtttttatggctgaaataaaaatgaacccggct
gggcccgtcttggaaaatgagacagtgaccctgctctgtagcaccccgaaggaggctccc
caggagctccgctacagctggtacaagaaccacattctcctggaagatgcccatgcctca
accttgcgcctgcctgcagtcacccgggctgatactggcttctacttctgtgaggtgcag
aacgcccagggcagtgagcgctccagccccttgagtgtggtggtcagatatccacccctt
actccagacctgaccaccttcttggagacacaggctggacttgtgggcatcttccagtgc
tctgtggtcagcgagcccctggctactgtggtgctgtcacacggaggcctcatgttggcc
tccagctctggagaaaatgacttcaacccccgattcaagatttcctctgcccccaactcc
ctgcgcctagaaatccgagacttgcagccagcggacagcggggagtacacgtgcttagct
accaactcccttggaaactcaatgtccagcatagacttctatgctaatgtggcccgactc
ctcatcagcccttcagcagaggttgtggaagggcaggcggtgactctgagctgcaggagt
ggtctgagtccagctcctgacactcgcttctcctggtacctgaacggagctctacttctg
gaaggatccagcagcagcctcctgctccctgcggcttccagcactgacgcgggctcatac
tactgtaggacgcaggctggccccaacaccagcggcccctccctgcctactgtcctcact
gtgttctatcccccacgaaagcccacattcactgccaggctggattcggatacctctgga
gtcggggacggacaacggggcatcctcttgtgccacgtagacagcgatcccccagcccag
ctacggcttctccacaaaggccgtgttgtggccacttctctgccatcaaggtgtgggagt
tgctcccagcgcacaaaggtcatcagagcctccaactcgctgcacgtggagatccagaag
cctgtattagaggatgagggcatgtacctgtgtgaggctagcaacacattgggcaactcc
tcggcctcagcctctttcaatgctaaggccactgtcctggtcatcacaccatcaaataca
ctgcgtgaaggtacagaggccaacctaacttgcaacgtgagccaggaggttgctgtcagc
cctgccaacttctcctggttccggaatggagtgctgtggacccagggaccactgaagact
gtgaggctgcagcctgtggccagagctgatgctgctgtctatgcctgccgcctcctcatc
gaggatggggctcagctctctgcttctgtggtcctaagtgtgctgtatgccccagaccct
ccaaagctgtcagccctcctggatgtgggtcagggccacatggccgtgttcatctgcact
gtggacagctatcccctggctcacctgtctctgttccatggggaccacctcctggccacc
aacttggaaccccagcgtccctcccatggcaggatccaggtcaaggccacagccaactcc
ctgcagttagaggtccgagaactaggtcttgaggactctggaaactaccactgcaaagcc
accaatgttcttgggtcggccaacagttcactgttcttccaggtcagaggagcctgggtc
caggttttgccatcacctgagctccgagagggccaggctgtggtcctgagctgccaggtg
cccacaggagtccccgaggggaccacatatagctggtatcaggatggccgccccctccag
gattcaacctcatctaccctccgcattgcagccataagtctgaggcaagctggtgcctac
cattgccaagctcaggccccagacacagctactgccagcctggctgcccctgtcagcctc
cgtgtgtcctataccccacgtcatgttacactcagtgccctgctgagcacgggccctgag
cgacttggccacctggtgtgcagtgtacaaagtgaccctccagcgcagctgcgactgttt
caccagaatcgcctcgtggcctctaccctacaaggcacggaggaattggcaagcagtaat
ccccggctgcatgtgactgtgctccccaatgagctgcgcctgcagatccactttccagag
ctggaggatgatgggacctatacatgcgaagccagcaacacactgggccaggcctcggct
gcagctgacttcgatgcccaggctgtgcatgtggctgtgtggcccaatgccactgtgcaa
gaggggcagcaggtgaacctgacctgcttggtatggagcacccaccaggactcactcagc
tacacatggtacaagggtgggcaacgactccttggtgccagatccatctccctgaccagt
gttacagttttggatgctacctcctaccgctgtggtgtggggctccctggccacgcaccc
catctctccagacccgtgaccctggatgtcctctatgctccccgaagcctgcggctgacc
tacctcctagagacccagggcaggcagctggccctggtactgtgtactgtggatagtcgt
ccacctgcccggctaactctcagccacggtgaccagctcctagcctcctcaactgaagcc
tctgtccccaacaccctgcgcctagagcttcaggacccaaggcctagtaatgaggggctc
tatagctgctctgcccacagccccttgggcaaggccaacacgtccctggagcttcggctg
gaaggtgtccgagtgaaaatgaatccctctggtactgtacccgagggagagcctgtcaca
gtgacctgcgaggaccctgctgccctctcacccaccctctatgcctggtttcacaatggc
cactggcttcaggagggaccggcttcctcactccagttcccggtgactacacgggctcac
gctggcgcttatttttgccaggtgcatgatgtacagggcacacggagctccagacctgcc
agtctgcaaattctctatgccccccgggatgctgtcctgtcttcctttcgagactcaagg
accagtctcatggttgtgattcagtgcactgtggacagcgagccacctgctgagatggtc
ctatcccacaatggcaaggtgctagctgccagccatgagcatcacagctcagcatcgggg
ataggccacatccaggtagcccgaaatgctcttcgactacaggtgcaagacgtgactgtg
ggcgatggcaacacctatgtttgcacagcccggaatacactgggctccatcagtaccacc
cagaggcttctgacggagactgatatacgtgtgacagctgagcccggcttggatgtgcca
gagggcacagctctgaacttaagctgcctcctccctggtggctctcggcccatgggcaac
tcttccttcacatggttctggaatcgccaccgactacattcagctcctgtgcccacactc
tccttcacccctgtgctccgggctcaggctgggttgtaccactgcagggctgatctcccc
actggggccactacctctgctccagtcatgctccgtgtcctctatcctcccaagacgccc
actctcacagtgtttgtggagcctcagggtggccaccggggcatcctcgactgtcaagtg
gacagtgagcccctggccatcctcacccttcaccagggcagtcaactagtagcctccaac
caacctcacggtgctcccgcccagccccacatccgagtcactgctcctcccaatgccttg
agagtagacatcgaggagcttggacctagcaatcaaggggagtatgtgtgcactgcctcc
aatgctctgggctctgcctcagcctccgcctactttgggaccagagctctgcaccaactg
cagctgttccagaggctgctatgggtcctgggatttctggcaggcttcctgtgcctgctg
ctgggtctggtggcctgtcacacctggagaaagaagagttctaccaagctgaatgagaat
gagaacgaggattcagcagagatggccactaagaaagatactatccaggaggaggtggtt
gccgctctctga

DBGET integrated database retrieval system