Mus pahari (shrew mouse): 110319321 Help Entry 110319321         CDS       T05929                                  Symbol Il1b Name (RefSeq) interleukin-1 beta isoform X1   KO K04519   interleukin 1 beta Organism mpah  Mus pahari (shrew mouse) Pathway mpah01523   Antifolate resistance mpah04010   MAPK signaling pathway mpah04060   Cytokine-cytokine receptor interaction mpah04064   NF-kappa B signaling pathway mpah04217   Necroptosis mpah04380   Osteoclast differentiation mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04623   Cytosolic DNA-sensing pathway mpah04625   C-type lectin receptor signaling pathway mpah04640   Hematopoietic cell lineage mpah04657   IL-17 signaling pathway mpah04659   Th17 cell differentiation mpah04668   TNF signaling pathway mpah04750   Inflammatory mediator regulation of TRP channels mpah04932   Non-alcoholic fatty liver disease mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah04936   Alcoholic liver disease mpah04940   Type I diabetes mellitus mpah05010   Alzheimer disease mpah05020   Prion disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05132   Salmonella infection mpah05133   Pertussis mpah05134   Legionellosis mpah05135   Yersinia infection mpah05140   Leishmaniasis mpah05142   Chagas disease mpah05143   African trypanosomiasis mpah05144   Malaria mpah05146   Amoebiasis mpah05152   Tuberculosis mpah05162   Measles mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05168   Herpes simplex virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05321   Inflammatory bowel disease mpah05323   Rheumatoid arthritis mpah05332   Graft-versus-host disease mpah05417   Lipid and atherosclerosis mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110319321 (Il1b)    04064 NF-kappa B signaling pathway     110319321 (Il1b)    04668 TNF signaling pathway     110319321 (Il1b)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110319321 (Il1b)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110319321 (Il1b)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110319321 (Il1b)    04620 Toll-like receptor signaling pathway     110319321 (Il1b)    04621 NOD-like receptor signaling pathway     110319321 (Il1b)    04623 Cytosolic DNA-sensing pathway     110319321 (Il1b)    04625 C-type lectin receptor signaling pathway     110319321 (Il1b)    04659 Th17 cell differentiation     110319321 (Il1b)    04657 IL-17 signaling pathway     110319321 (Il1b)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     110319321 (Il1b)   09158 Development and regeneration    04380 Osteoclast differentiation     110319321 (Il1b)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     110319321 (Il1b)    05164 Influenza A     110319321 (Il1b)    05162 Measles     110319321 (Il1b)    05168 Herpes simplex virus 1 infection     110319321 (Il1b)    05163 Human cytomegalovirus infection     110319321 (Il1b)   09171 Infectious disease: bacterial    05132 Salmonella infection     110319321 (Il1b)    05135 Yersinia infection     110319321 (Il1b)    05133 Pertussis     110319321 (Il1b)    05134 Legionellosis     110319321 (Il1b)    05152 Tuberculosis     110319321 (Il1b)   09174 Infectious disease: parasitic    05146 Amoebiasis     110319321 (Il1b)    05144 Malaria     110319321 (Il1b)    05140 Leishmaniasis     110319321 (Il1b)    05142 Chagas disease     110319321 (Il1b)    05143 African trypanosomiasis     110319321 (Il1b)   09163 Immune disease    05323 Rheumatoid arthritis     110319321 (Il1b)    05321 Inflammatory bowel disease     110319321 (Il1b)    05332 Graft-versus-host disease     110319321 (Il1b)   09164 Neurodegenerative disease    05010 Alzheimer disease     110319321 (Il1b)    05020 Prion disease     110319321 (Il1b)    05022 Pathways of neurodegeneration - multiple diseases     110319321 (Il1b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110319321 (Il1b)    05418 Fluid shear stress and atherosclerosis     110319321 (Il1b)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     110319321 (Il1b)    04936 Alcoholic liver disease     110319321 (Il1b)    04932 Non-alcoholic fatty liver disease     110319321 (Il1b)    04933 AGE-RAGE signaling pathway in diabetic complications     110319321 (Il1b)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     110319321 (Il1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110319321 (Il1b)    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110319321 (Il1b) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interleukins    110319321 (Il1b) Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Cytokines    110319321 (Il1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep ZinT Motif Other DBs NCBI-GeneID:  110319321 NCBI-ProteinID:  XP_021050470 Ensembl:  MGP_PahariEiJ_G0025731 LinkDB All DBs Position 3:complement(112533890..112540504) Genome browser AA seq 275 aa AA seqDB search MKVCLLSADKELSFDHVCFHYSDENDLFFEVDGPQEMKGCFQTLDVGYPDESIQLQFSQQ HINKRFRQAVSLIVAVEKLWKLPGSFPWTFQDEDMSTFFSFIFEEEPILCDSWDDDDDLL ECDVSIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNINQQVVFSMSFVHGETSNDKIP VALGLKGKNLYLSCAMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAQF PNWYISTSQAEHKPVFLGCNSGQDIIDFTMESVSF NT seq 828 nt NT seq  +upstreamnt  +downstreamnt atgaaagtctgtctgctcagtgctgataaggaactatcatttgaccatgtctgttttcat tacagtgatgagaatgacctgttttttgaggttgacggaccccaagagatgaagggctgc ttccaaacccttgacgtgggctatccagatgagagcatccagcttcagttctcgcagcag cacatcaacaagcgcttcaggcaggcagtgtcactcattgtggctgtggagaagctgtgg aagctacctgggtctttcccgtggaccttccaggatgaggacatgagcaccttcttttcc ttcatctttgaagaagagcccatcctctgtgactcatgggatgacgatgatgacctgttg gagtgcgatgtttccattagacagctgcactgcaggctccgagatgaacagcaaaaatgc ctcgtgctgtcggacccatgtgagctgaaagctctccacctcaatggacagaatataaac caacaagtggtcttctccatgagctttgtacacggagaaacaagcaacgacaaaatacct gtggccttgggcctcaaaggaaagaatctatacctgtcctgtgcaatgaaagacggcaca cccaccctgcagctggagagtgtggatcccaaacaatacccaaagaagaagatggaaaag cggtttgtcttcaacaagatagaagtcaagagcaaagtggagtttgagtctgcacagttc cccaactggtacatcagcacctctcaagcagagcacaaacctgtcttcctgggatgcaac agtgggcaggacataattgacttcaccatggaatccgtgtctttctaa

DBGET integrated database retrieval system