Mus pahari (shrew mouse): 110319812 Help Entry 110319812         CDS       T05929                                  Name (RefSeq) histone H2A type 2-A isoform X1   KO K11251   histone H2A Organism mpah  Mus pahari (shrew mouse) Pathway mpah03082   ATP-dependent chromatin remodeling mpah04217   Necroptosis mpah04613   Neutrophil extracellular trap formation mpah05034   Alcoholism mpah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpah00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     110319812  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110319812  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110319812  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     110319812   09165 Substance dependence    05034 Alcoholism     110319812  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpah03036]     110319812   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110319812 Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110319812 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110319812 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  110319812 NCBI-ProteinID:  XP_021051064 LinkDB All DBs Position 4:86441639..86442296 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgaggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcggtcgtcc cgcgccgggctgcagttcccggtggggcgtgtgcaccggctgctgcgcaagggcaactac gcggagcgcgtgggcgccggcgcgccggtgtacatggcggcggtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaaa gtgacgatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgttgcccaagaag acggagagccaccataaggcgaagggcaagtga

DBGET integrated database retrieval system