KEGG   Mus pahari (shrew mouse): 110319931
Entry
110319931         CDS       T05929                                 
Symbol
Ntng1
Name
(RefSeq) netrin-G1 isoform X1
  KO
K07522  netrin-G1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04360  Axon guidance
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110319931 (Ntng1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110319931 (Ntng1)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF EGF_2
Other DBs
NCBI-GeneID: 110319931
NCBI-ProteinID: XP_021051322
Ensembl: MGP_PahariEiJ_G0026995
LinkDB
Position
4:complement(99355258..99703704)
AA seq 539 aa
MYLSRFLSIHALWVTVSSVMQPYLFVWGHYDVCKSLIYTEEGKVWDYTACQPESTDMTKY
LKVKLDPPDITCGDPPESFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLHAFHMDPKSVKDLSQHTVLEIICTEEYSTGYSTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATSCLYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWYYGCQPNVCDNELLHCQNGGTC
QNNVRCACPDAYTGILCEKLRCEEAGSCGSDSGQGAPPRGSPALLLLTALLGTANPLVF
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgtatttgtcaagattcctgtcgatccatgccctgtgggttacagtgtcctcggtgatg
cagccctacctgttcgtgtggggacactatgatgtatgtaagagtctgatttacacagaa
gaaggcaaagtttgggattacacagcctgccagccggaatccacggacatgaccaagtat
ctgaaggtgaagctggatcccccagatattacctgtggagacccaccagagtccttctgt
gcgatgggcaacccttacatgtgcaataatgagtgtgatgcaagtacccctgaactggca
caccctcctgagctgatgtttgattttgaaggaagacacccctccacattttggcagtct
gctacttggaaggagtaccccaaacctctccaggttaacatcactctgtcttggagcaaa
accattgaactaacagacaacatagttattacctttgaatcggggcgtccagaccaaatg
atcctagagaaatctcttgattacggacgaacatggcaaccctatcagtattacgccaca
gactgcctccatgctttccacatggacccgaaatccgtgaaggatttatcccagcacacg
gtcttggaaatcatttgcacggaagagtactccactgggtactccacgaatagcaaaata
atccacttcgagatcaaagacaggtttgcatttttcgctggacctcggctacgaaatatg
gcttccctctatggacagctggatacaaccaagaaactcagagatttcttcacagtcaca
gacctgaggatcaggctgttgagacctgccgttggggaaatatttgtagatgaactacat
ttggcacgttacttttatgcgatctcagacataaaggtgcgaggaaggtgcaaatgcaat
ctgcatgccacgtcatgtttgtacgacaacagcaaactgacatgtgaatgtgagcacaac
actacaggtccagactgtgggaagtgcaagaagaattaccagggccgaccttggagtcca
ggctcatacctccccatccccaaaggcactgccaacacctgtatccccagcatttccagt
atcggtaactgtgaatgcttcggccactccaatcggtgcagttatatcgatctgctaaac
acagtcatttgcgtgagctgtaaacacaacactagagggcagcactgtgagttatgcagg
ctgggctacttcagaaatgcttctgcacagctggacgatgagaatgtgtgcatagagtgt
tattgtaaccctttgggctcaatccatgatcgttgtaatggctcaggattttgtgagtgt
aagactggaacgacagggcctaaatgtgatgagtgtctgccaggaaattcctggtactac
ggctgtcaacctaatgtctgcgacaatgagctcctgcactgccagaatggagggacctgc
cagaacaatgtgcgctgcgcttgcccagacgcctacaccggcatcctctgtgagaagcta
cggtgcgaagaggcgggcagctgtggctccgactccggccagggagcacccccgcggggc
tccccagcactgctgctgctgaccgcgctgctggggactgccaaccccctggtgttctag

DBGET integrated database retrieval system